SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14917 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14917
Domain Number 1 Region: 534-727
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-38
Family Fibronectin type III 0.00025
Further Details:      
 
Domain Number 2 Region: 850-1041
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-35
Family Fibronectin type III 0.0002
Further Details:      
 
Domain Number 3 Region: 440-572
Classification Level Classification E-value
Superfamily Fibronectin type III 2.68e-28
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 4 Region: 334-424
Classification Level Classification E-value
Superfamily Immunoglobulin 4.97e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 137-234
Classification Level Classification E-value
Superfamily Immunoglobulin 5.05e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 6 Region: 246-341
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000154
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 735-830
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000839
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 8 Region: 44-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000134
Family I set domains 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14917   Protein: CBP32823   Gene: WBGene00035291
Sequence length 1407
Comment CBP32823 WBGene00035291 locus:Cbr-unc-40 status:Predicted UniProt:A8XKZ7
Sequence
MGCDCYILIILTVYLSTTLATTRKHHRRSTENDPRSLGFQFEVEPRRNVTVSESTSHLLE
CSYVLAHERYVQTVRVEWKRDGVMLSERSSSRIKVMSNGSLWIEAMSSAEEGTYQCAVHV
TSKNDLAIDTWTFLSRKATLRLADLSKFELQPVDRTVAKGQPTAFHCLINSKPTPSAVWL
HNDQPIVNGGEYHILPVSNTLEISSVQSRHEGTYRCTVEGAGKRRSSQTARLAVTIGRKV
SNELSFITTPRLQVVEQGGEFLLECLVASRIRPQVRWLKDSRQIIVDGVRIRRVGVSSIL
VSRSSIEDTGLYTCRASNNDDSIDRAVSVEVRAPPRITTRPATKVAVETADVELECGTAA
ARPEARVSWYKNGEAIIGSEYFVIEPSRLRILGVVRADQAIYQCIAENDVGSEQASAQLL
VDAPDSSSVAASSGVPMTASAPLGLRSTSSGSRFINVEWDPPVQRNGNIMRYHVFYKDNS
IDRERMINSSSTSATLTSLQPFTMYLIRVTAENEAGMGKFSDSLKVTTNKEQAVPGKVTS
LVATATGPETIDIRWSPPSGGQPALRYKIYYSHDPLEKSEKETLITTSTTHYTLHGMDKY
TGYQIRIEAEGANGSGLSSDTVRIRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEKYSV
NGEVTGYRLKYKTKARGAKGNTLVIDATSREYTMGNLEPNTQYLIRMAVVNHNGTGPFSE
WVAVDTPGQDKEERTLGAPREIRPHAGIDYILVSWLPPADEQNLVRGYQIGWGLSVPDTE
TIRVTASTTQYKISRLSSERDYVISLRAFNNLGSGFPIYETVRTLSRETPHFSEDSDSDD
ADGQLGSSESTPVGLRTEAVSGTSIRVMWTESDESAFNTQYTVRYSTSVDGNQHRYVNST
ETWATVEGLRPATEYEFAVRAVASNGQLSTWSMAARNRTWSAPPSSAPRDLTVLPAESGD
PHSASLHWQPPKYSNGEIEEYLVFYTDRESLSDKDWTINYVAGDKLSHQVSNLLPKANYF
FKIQARNEKGHGPFSSIVGYTPSGGAILSGRDRNVPRGHGSAMGDTVSLIEQLQSIFQTN
PLYLMLLIAFALILILTLILIIMCCLKRSGGGGRKNGYQSAKKTSGSGGVGGGIGGPPND
LWINGTGSHMRAGASDYMVDGLATAHLTAADIDSPTPRYHHLQGQGTLTRSYHQSSQSLE
GRQRTPQVVYTGTGRHQPIHKIDFDSPYGSSSAIGSASTPPLPPMQAPPSGPPTVIDGYR
TLRGTPPNSSAANALRSFTQLAGATPPPPHSATSTSSMRPTIIAAGGRQVPVGRATAQPR
VNVANIYSPFASCSASSDAGDSDKKGECMEMRETTPVKTTGSDKIVANMLPSHSTEDLNA
HLESLDTMLDDLQQLQHNLHLDTSTDK
Download sequence
Identical sequences A8XKZ7
6238.CBG14917 CBG14917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]