SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14955 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14955
Domain Number 1 Region: 15-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-21
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 2 Region: 149-234
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-17
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 3 Region: 252-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14955   Protein: CBP25422   Gene: WBGene00035327
Sequence length 334
Comment CBP25422 WBGene00035327 status:Predicted UniProt:A8XL33
Sequence
MLSLHAIHFADIGFMYPPNVDCVRVIHSRPQHDVIVKFHHVFHIESTYDKIEAGEECPND
FIEFRDGRYGFSPLIGRFCGDRMPKREIRAVSGFLWIRFRSDAMLEYQGFSAEYAIVPSK
TGRFNNHECLLEYLNGLDGFIRTKDLIANLPRNASGTLDCVWRLAVPSNFRIAFYVKEFA
LKAPNQCAYNFVEVYSGDTSDKPLRRFCGLTANDVFSPSNEMFVRFYLSDVRSLNTTSIS
ALFSSYTRMKNCTQEGLFACGDENCVPNSLACNGRPNCPYGRDERVCSVGQDTIFNFLAS
GFVPLVSIIFIVLIVISLICFYTIRKNHCALPPL
Download sequence
Identical sequences A8XL33
CBG14955 6238.CBG14955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]