SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG15191 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG15191
Domain Number 1 Region: 1153-1228
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-18
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 2 Region: 67-142
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-17
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 3 Region: 771-859
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 298-362
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000201
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 5 Region: 382-482
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000279
Family Fibronectin type III 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG15191   Protein: CBP31778   Gene: WBGene00035514
Sequence length 1337
Comment CBP31778 WBGene00035514 locus:Cbr-tag-168 status:Predicted UniProt:A8XLQ4
Sequence
MLGGLSGPGPPPPPPPPSTSTYGQLLPGPSTGPSCSTTSFTNHLGPTTTSQTTVLPSSDT
LLLQLRSRPNSRVFRALFQYLPLRDSPNENPQLELSLQPGDVVLVKGEMDSDGFYCGETL
DGRQGLVPSNYVERVPDSVLLANARAPSPSFPLRIPQHFSTIQHDFSSPDHSTLPDSVCP
YPPADVTKVTVQEIKNSETPRSEFIILSKKNVSIQCTRKTRKTLKYPPEESFVAVSQYHV
CVDGAVRAIVPGTYKCRALVEDIPLESSVNLSVRAVTEHGHSPDACCTIAIGNEAQVAPQ
QVRVWAVTPVSACVRWYPSNSNAEHVVSLNAVKVGVCPPTVFQVQLQGLQPSTIYRVSVR
TKHPKAVLEQRPVERCIDFKTLPKIGLPDPPTHVQVEIGPQPGTLLVSWQPVSNQPKPPS
RAAVHSYLIYADGKNIAQVPQATADHVVLRLSDLSDDPPIFITVRTKTKEGAVSSDSNVA
RVPRTQGVVVPSTTQQQQLIGTVDPTSGLPLVDMTSSYPSYHQQQQQSVANSIYMPIGST
GTLTNAHPPLANGHVTHQAATGPYSAPSTAPARMVGATGLMSYQQTSYPNVQASMQQSAP
ASAPNVQSGGYATFDRSASLGAQPSSILLAGGSAPRPSSVGQTVQSTWQQPTKPATNQMS
QYYTFHPNFLHTEPSGADEPRPSVLEMENSYLMRHRQAADWANAPESRDARARIEAYSRG
LNRAGSADERMHYGGSVVVGGPLGTRHPMSQTLQQRLMQPRLQRVKSESGFGTRSEPDLR
PPTLDSDECRWFVALFDYTAAMSPNPNAEFEELQFRKHQLIKVYGPQDVDGFYHGQIGNR
IGLVPSNMVIEIASDDIGKRRTTGAPAPPPPTQPEPALRRQRWGSKILDLGSKTNQKQHF
RPHHPNYISLDRRDDRDRDRDGGRYRRQGAISSYEYRRLPEREDAPYRRRQPVIDARDDV
YDDEGYRDRDRDRRMDREGRLGDRIDRDRLDRDRIDRDRLDRDRLDRDRVDRGDRGYDRM
DRSLDARRHPMDRRQTDDRYPPYDPYARGDKYRERPRMDEQQQSQAPPPQNNYDYPPSRY
DQQPGPSNQQQQQQQQQMSQMTHQMGQLHMNQAGQQVPIGIPSSSGIGGMGGAGIQMGGA
IGEYQNGGMTAGGQKMARMIAKFDYDSRQLSPNVDAEQVELSFRQGDVITVYGDMDEDGF
YMGELNGLRGLVPSNFLQPTPLNNLLPSQPTEPMRKGVAFSDTQQMIRKSAPIRQSSQTG
STAGQPATSLASAVASAAAVSKPVAKKSTAGTGGAAGKPLAKKTSDVGKSAAPNARKTST
AVKKADTGAKVIDQLAA
Download sequence
Identical sequences A8XLQ4
CBG15191 6238.CBG15191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]