SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG15423 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG15423
Domain Number 1 Region: 588-778
Classification Level Classification E-value
Superfamily Fibronectin type III 5.81e-17
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 2 Region: 469-555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000393
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 30-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000341
Family I set domains 0.062
Further Details:      
 
Domain Number 4 Region: 264-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000112
Family V set domains (antibody variable domain-like) 0.047
Further Details:      
 
Domain Number 5 Region: 146-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000017
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG15423   Protein: CBP03747   Gene: WBGene00035699
Sequence length 1170
Comment CBP03747 WBGene00035699 locus:Cbr-rig-1 status:Predicted UniProt:A8XMB0
Sequence
RFDTMILLFFICFLVRTGITELESQLFDLPSLYVKTDQLYLHKRNTTNLTCELSSGYSEA
RMKSVIWLKDNEVISLNDTDYVWQGFILIIVGSTPQNEGEYQCIAEMTKIRLSNRQLITT
TIISSPLRIRRARFTKFDENVNNTAITVRENDIIRLPCAGMPDVIPAPAQLCFRRLENED
ECLGGRNDTKYFVTETGMQISLVTPSDAGFYHCFVTNEYLNQTKMSPKPLLLIVSEANRT
EKAKAEALKPRLVYPTRETTIDKPIKLTVAEGEDILLECVMNMAKVVWIKHNDTTPNVTM
EDNMSRFQQIWGNLKIRSIAAGDAGIYTCLGLPIVGGDGIIDNNSTRPRIDYSLNVVSPS
GVRLSISSLYDKRYLLECLATNMRYEIPTAYINGTSIIHNINELGIPSNTNFYNNPIRVH
MEVKRSFTGSIQCVSRPAMVEAEIYGYGLETGKSMNMYVMNTLNSNDLIIKGPNNITVLI
GNVADFPCIVQRVKARSWMKNNRTLSLFTARRTILGSNSLRIKKVELDDEGMYTCVAQSE
SGITSYSSAYLTVIDNSTTPAPVVTSTEPFADKKKDMRIDVEDVRGFVTGTEVRIQWSVL
GKMEALTKIAKFIIEVQTFGASEESWIEADSVDSHVRATTIKSLISDNKYKFRIKMVRDD
GSHVLSLPTDWMTVEATSGDVLPLAPKIITVYQHSTSSAKVLFSHNVPIENAAAKTFVIV
YNEVSSAQNKSQVIQVDGDQNDAIITGLNFDTEYSIRAIAENAAGKSVHSAEYLFNTTRK
SSFLELVAPETFALIFVFICFFVLVESFPSRKISDCYQMCGVGRKRRYKRMGSVRVSRVQ
TKSQTAINCKITFLRLHCFNYSLNNISDNGMLASVRIFLGTIEPHLTFKNIALGGIVTFL
ALIIVLVCFFVFCNLRSGKGKQKSQANGKFLDASYRIFNEQKVHKSRMFDDNAEILEADV
DECSPLKVRQVDERHSGDSDKYGFHNHDENLPNLYGNMDDIMDMEEHAEIPNDPTYVSAA
KINGDYGVHSTARCYSPESRTSHEMLVSYSRSAPHSTTNGSSPQMNGSMQRVKAYNYADS
LLYSPAGTTSSIAETNSSGHGGHRGHCDSPNTAPASDESDQGIRCGGSSRNSHISSTDGT
KIMTMGTFKGSTPTSSFVSTFDRRRSENVA
Download sequence
Identical sequences A8XMB0
CBG15423 XP_002645366.1.8413 6238.CBG15423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]