SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG15443 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG15443
Domain Number 1 Region: 100-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000534
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 13-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000161
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG15443   Protein: CBP03750   Gene: WBGene00035708
Sequence length 197
Comment CBP03750 WBGene00035708 status:Predicted UniProt:A8XMA1
Sequence
MAPPSIYGEPKIRSENGSVFLEVVVTGADVSKIQWFFGADELEENEFLKFSNSDEGGNRT
LFVAEIKDFDKPLAGEYKAVFANADGENSAAFTVTAGNAPDFHDKPHIVQRDNGNVIVIK
VRAKSHLEMKAEWFKDDKPVKFTDRVKAVVKKDDKDKDGFQFLLEITGPIKEDEAKYKCI
VKNSEGQNQQSLNLVFD
Download sequence
Identical sequences A8XMA1
CBG15443 6238.CBG15443 XP_002645375.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]