SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG15732 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG15732
Domain Number 1 Region: 1214-1510
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-73
Family Protein kinases, catalytic subunit 0.000000333
Further Details:      
 
Domain Number 2 Region: 493-658
Classification Level Classification E-value
Superfamily L domain-like 2.18e-31
Family L domain 0.00035
Further Details:      
 
Domain Number 3 Region: 191-375
Classification Level Classification E-value
Superfamily L domain-like 3.12e-31
Family L domain 0.00085
Further Details:      
 
Domain Number 4 Region: 665-706,745-832
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000455
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 5 Region: 354-503
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.00012
Further Details:      
 
Domain Number 6 Region: 1011-1154
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000114
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG15732   Protein: CBP37575   Gene: WBGene00050887
Sequence length 1840
Comment CBP37575 WBGene00050887 locus:Cbr-daf-2 status:Partially_confirmed UniProt:A8XMN1
Sequence
MVRSRRRHKTILKDSGATTSSSDSDDVEDSLLPSTSSSHLEESSRRNSTITSSNDVDIIQ
YRYYSHVINNEDNVDDVSEFRIHKMRRRRDSSSHRTRRRTMISTSSECSTSSSAPTTSLS
SLCRRTASIIFLLLSLCAIFQPCSSIREIRCPPIDIRNKPWGIKTRPSLIGDKDQINYFY
DRSNNASWPPVNHMINCTVIEGSLSLSFIYGGGHSNDPREMKNLEQSDYPIFPNLREVTG
TFLVFETKGLVDLGKMFPQLRVIGGQTLVQHFALIIYRNHQLEAINLPKLSVVRNGGIRV
QDNKYCCHVTSIDWKSLIQSPINDVVVDDAAEWSVTETGKVCPKTCDTEPNYKDRCREYM
TPEGKQVQSCWSDTACRRKCPYERFDNGTMGPGCSPEGERCHEQCLGGCDAPNDDTQCSA
CRHLHYNGKCVAKCPKNMYVLMGRRCVTKAECLALNPKQKNIFQHIKATDGLCSDKCPEG
WEINKKDIRFCKKCDGPCEITCTIDHKIDTFPKALALRRCNIIKGNLTIEIRGKQESGMA
AELKEVFANIHTITEYLHIMRSPPLLSLAMFKRLKLIRGDTLFLNKFAISVVENDNMRSL
FEDNREIVFGNKNATVQFHNNRMLCFELITDLTKMLGINKTHDDDQSPNSNGDKAICATS
LITVKLGAVSDDSIHFSWAQLDLTDSDFRKFLGYELFYKYQKAVFLLSGSGQNRSKMTID
DDRSACVDSWSSVFIQHYEDGKKVIEATLLAKDRIRPNTLYAYYVATQMVRHPGARNGIS
KIGFVRTKYAVPDPPMVRVDAVSQNSIKLVWDPPHHSNGDITFYTISWRELDIDVHAEAM
RFCNEEGTMVATRYEDDTSDKPDKEVSISMYSPFTSNDTCSASAGCCACSALASSDDRSL
TTPDPDKRANIREKRSIQNAKEQDEMLARKEKKFFKKSPETSGQTDTPNEKDQDIGKETT
DEEIKRLLAGDKQEQNENDSSTNSTVAPEAKPTVAVMDEILYPANVNTINVTAKATGNQW
LLGNLKHYTIYAITIQACQNTSNFPHYCSVPHKAATKKRTLAKPDIDKVDQSTIMTIQDK
QEPNKVHITWNHPDETNGGVLGYMVTVKNSMEIPVCVPNTKGFDPTTHGTVFRDLSEGSY
EIGIVTYSAASNGERVKRQAMYEVSMPSFWLWWRLLLVGLFIFCLIAAIAGVVYYNVRYK
FGKRVKKLADFMHMNPEYCVDNKYTIDDWELEKESVTLGEVIGQGTFGKVYLAQGKKCVS
IRGDAFGPCAVKINTEEAAESLENMNYLMEANVMKNFKTTFIVKLFGVVSSVHPAWVVME
FMELGNLRDYLRAKREEEVFDENNCNFYNIVPREKICEWAAQICDGMAYLESLKFCHRDL
AARNCMIDKTELVKIGDFGMARDLFYHDYYKPSGKRMMPVRWMSPESLKDGKFDSKSDIW
SFGVVLYELITLGAQPYIGLSNDEVLNYIGMARKVIKKPDCCSEYWYKIMKMCWRYAPRD
RPTFLQLVHLLSAEASEEFKTLSFVFTENQMAMEDTEPLDLDEIYNYNPPEELDPAAMDA
QVMEEERKGGRRMTDSIPMKEFKSDGLRKNGGGTGGGSSHSTISMGSTMIPMKPKRRQGS
LDEEYTLMNHSRGPSDTEIRTYTGDEGDYVERDVAADVPTRRNTGASNCSYTGGPYCLTN
RGGSNERAGFGEGLRLTDGVGSGGHLHEDSYYSDNQLNSMDTRRSTGASTASYGAPPQTK
WSGSQTKGATYFEKQKQMQAAAEAAAKKAKLSGVGDHPVVIPTGFNGDPDYTETEPPLSK
GSPSKNGNTGYHHHGHHGPPHRGNGRTAFGETERLIEEHP
Download sequence
Identical sequences A8XMN1
CBG15732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]