SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG16045 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG16045
Domain Number 1 Region: 2485-2574
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 785-882
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-21
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 2280-2384
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-21
Family I set domains 0.0062
Further Details:      
 
Domain Number 4 Region: 1357-1456
Classification Level Classification E-value
Superfamily Immunoglobulin 9.94e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 885-981
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 2090-2185
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 520-616
Classification Level Classification E-value
Superfamily Immunoglobulin 5.24e-18
Family I set domains 0.082
Further Details:      
 
Domain Number 8 Region: 2663-2760
Classification Level Classification E-value
Superfamily Immunoglobulin 5.49e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 710-799
Classification Level Classification E-value
Superfamily Immunoglobulin 6.05e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 1266-1364
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 1008-1094
Classification Level Classification E-value
Superfamily Immunoglobulin 9.19e-18
Family I set domains 0.0093
Further Details:      
 
Domain Number 12 Region: 1102-1181
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 2757-2851
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-17
Family I set domains 0.034
Further Details:      
 
Domain Number 14 Region: 1910-2005
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 15 Region: 1185-1273
Classification Level Classification E-value
Superfamily Immunoglobulin 6.7e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 16 Region: 1466-1548
Classification Level Classification E-value
Superfamily Immunoglobulin 8.92e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 17 Region: 604-697
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 18 Region: 2390-2477
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000116
Family I set domains 0.017
Further Details:      
 
Domain Number 19 Region: 37-213
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000125
Family Integrin A (or I) domain 0.072
Further Details:      
 
Domain Number 20 Region: 1822-1916
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000014
Family I set domains 0.019
Further Details:      
 
Domain Number 21 Region: 2013-2100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000156
Family I set domains 0.012
Further Details:      
 
Domain Number 22 Region: 1651-1739
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000495
Family I set domains 0.023
Further Details:      
 
Domain Number 23 Region: 2190-2287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000588
Family I set domains 0.042
Further Details:      
 
Domain Number 24 Region: 1557-1644
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000111
Family I set domains 0.026
Further Details:      
 
Domain Number 25 Region: 429-521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000267
Family I set domains 0.046
Further Details:      
 
Domain Number 26 Region: 2576-2666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000747
Family V set domains (antibody variable domain-like) 0.083
Further Details:      
 
Domain Number 27 Region: 1732-1824
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000165
Family I set domains 0.013
Further Details:      
 
Domain Number 28 Region: 2843-2890
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000687
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG16045   Protein: CBP10276   Gene: WBGene00036118
Sequence length 2899
Comment CBP10276 WBGene00036118 locus:Cbr-him-4 status:Predicted UniProt:A8XN78
Sequence
MGRSPCWLLWVIGLLLMTKLCLSNTDDKNDPTGKSSLAFVFDITGSMFDDLVQVREGAAK
IFKTVMAQREKLIYNYIMVPFHDPYLGEIINTTDSTYFMRQLSKVYVHGGGDCPEKTLTG
ILKALQISLPSSFIYVFTDARSKDYHLEDEVLNTIQEKQSSVVFVMTGDCGNRTHPGFRT
YEKIAAASFGQVFHLEKSDVSTVLEYVRHAVKQKKVHLMYEARERGGIVSRKIPVDKHLS
ELTISLSGDKDDSDNLDIVLKDPEGRTVDKRQYSKEGGTIDLKNVKLIRLKDPTPGVWTV
TTNSRLKHTIRVFGHGAVDFKYGFASRPLDRIELARPRPILNQNSYLLVNMTGLLPPGTV
GEIDLVDYHGHSLYKSTASPHRTNPHIYFAGPFIPPKGLFFVRVQGYDEDNFEFLRIAPT
AIGSVVVGGPRAFLSPIHQEFVGRDLNLSCTVESASPYTIYWVRTGEEIIGGPLFYHNTD
TSVWTIPELSLKDAGEYECRVISNNGNYSVKTRVETRESPPQIYGVRNVSVPIGESAFLH
CPTRSAGEVEIRWTRFGSTVFNGPNTEKNPINGTLKIHHVTRADAGIYECMARNAGGMST
QKMQLTIMEPPVARVSPKEIYYNIRDNVNLTCQGHGDPKPELHWYRGRQRMMTDYRALLG
PDAKYLILRDANAHDEGTYECKAMNLAGVASDTVDVILASTPKVEIIQNKMMVGRGDRVS
FECKIIRGKPVPKIRWFKNGKDLIKTDDFIKVNEGQLHIMGAKDEDAGAYSCVGENIAGK
DVQVANLSVGRVPTIIESPHTVRVNIERSVTLQCFAVGIPTPEIEWQKGGIPIISEKNLR
YTQLPDGNLQINDAQIEDQGQFTCVAKNTYGQQSQTTTLMVTGLVAPILGHVPPEEQLIE
GQDLTLSCVVVLGTPKPTITWMKDNRPVQESESVQIIGGGSLLRLKGGKASDEGKYTCVA
SSPAGNSTIIVNVQLIKKPEFVYTMEGGNVVKPDVSGFELNQVATVNSTHDVLDGGQFAI
PCAVSGTPPPAITWYLDGRRIVPNSKDFAILADNTLVVKKADKSHNGVYTCTAVNSAGEN
EQKTTVRILSIPAISPGQTSFNMVVDDQIIIPCDVYGDPPPKITWLLDGKPFEDGVVNED
GSLTIERVKEEHRGTFTCHAQNAAGNDTREVTLTIHTTPTISAENQEKTALQNETIVLEC
PAQALPPPVRVWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFSCQVSNLAGEDSL
SYTLTVYEKPKIISEVPGFVDVVKGFTIEIPCRATGVPEVIRTWNKDGIELNLDGAKFSV
DNLGTLRIYEATRDDIGNYNCVVQNQAGKSEMTTNVDVQEPPVISPSTQINNTAVVGDRV
ELKCYVEASPPATVTWSRRGIAIGTDTKGYDVESDGTLVIHSATVEDATIYTCKATNPAG
VAEANLQVTVIASPDIKDQDVVTQESVKESNPFSLYCPVFSIPLPQISWYLNDKPLIDND
ATWKLSDDKRKLHVFKAKIADSGVYKCVARNAAGEGSKSFQVEVIVPLSLDESQYKKKVF
AKEGEEVTLGCPVSGYPTPKVDWVVDGTLLRAGGEYKGARLSDDSLTLHFDSVGIKNEGK
YHCIAQSKGSTLDVDVELSVLAIPIVGDDEELEVLIDKDISLSCELLTESDDKTTFVWSI
NEIENERPKNAQIPSDGHRMYITNAKPENSGKYICRVTNSAGKAEKVITLKVLEPPVFVE
GEVETNRKLIGSNPVILACLATGNPQPIITWKIDGEDVDKNLLLDESHLRIETLNTKSVQ
ITCSAENKAGAISRDFYVQNIAAPTFKDGGESSTTFRESDTITLDCPVSLGDFEITWMRQ
GNKLTEKDAIFTLDNTRLSILNANRNHEDVYTCVANNTAGQVSKEFGVKVLVPPKIKHVL
VTLEPNEGEEVIMQCNAEGNPQPMARWDFNQGQLPKDAKTVNNNHTVVIQEADKRHTGVY
KCYATNDVGQAVKTINVNVRTRPRFDSGVTDVNVTVDLSRSATLECDTDDALGIAITWTV
RGKPMLVDTDGIQLLAGGRFLHIVSAKTEDIGEYACTVTNDAGVATKNFNLAVHVPPTIV
NEGGIYTVIENNSLVLPCEVTGNPTPVVTWTKDGKPLGDLKSVQVLSEGQQFKIVHAEIA
HKGSYICMAKNNVGSAEISFDVDIITRPMIQKGIKNNIDVIKGNTATLKCPIEDDKNYKG
KIIWTFDGRVIDFNEVGPRISHVSNDRRIAIHNATEADDGAYSCRVKNDAGENNFDFKVN
VHVPPKILILDKDLNKTVTESGSLTLSCPATGKPDPAISWFKDGDVIHADNIQNIIPNGE
LSGNVLKISRVMEEDAGRYTCEADNVAGSDEQDVIVSVQTIPKIEKDGIPSEYESQKDER
VVISCPVYAKPQAKIIWLKAGKPLESDKFVKTSANGQKLYLFKLRDTDSSKYTCIATNPA
GSDKRDFKVSMLVAPSFDEPNIVRRISVNAGRHTILSCPAKGSPIPTITWLKDGRAIEPN
DRYVYLDSGKLLQISDVEGGDQGRYTCIATNSVGSDDLENTLDVVIPPVIDGEPKETISI
IEGFPKDLLCESNSTNGDVEWQKDGLTINQQTLRGDSFIQIPSSGKKLSFLSPKKSDSGR
YTCIMRNPAGEARKVFDFTVNLPPSISDELSSNTILTMVSNGVLEINCVVSGSPHPKVTW
LFNDEPVENDENHEFNANGETLRLKYLTESHAGTYTCKAENVVGEATKDFYVRYTAPPNF
DTQEEVIVAKVGDSVFLTCHAKSSTPITFVKWSAKDEEVDASDTKYAATDKTMNVTNIQL
DDEGVYFCTVVNDAGRTTKYFKISVIEPPSFNDKQELYPIVYGKTLSIDCSAIGTPIPTI
IWMKEPGLALKFLTSLKTL
Download sequence
Identical sequences A8XN78
CBG16045 6238.CBG16045 XP_002643421.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]