SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG16558 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG16558
Domain Number 1 Region: 1024-1227
Classification Level Classification E-value
Superfamily Fibronectin type III 2.06e-27
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 1615-1837
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-27
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 3 Region: 12640-12825
Classification Level Classification E-value
Superfamily vWA-like 7.47e-26
Family Integrin A (or I) domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1318-1521
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-25
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 5 Region: 12855-13039
Classification Level Classification E-value
Superfamily vWA-like 2.86e-23
Family Integrin A (or I) domain 0.0031
Further Details:      
 
Domain Number 6 Region: 423-521
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-16
Family Fibronectin type III 0.00068
Further Details:      
 
Domain Number 7 Region: 609-708
Classification Level Classification E-value
Superfamily Fibronectin type III 4.51e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 8 Region: 335-422
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000108
Family I set domains 0.027
Further Details:      
 
Domain Number 9 Region: 13087-13266
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000128
Family Integrin A (or I) domain 0.027
Further Details:      
 
Domain Number 10 Region: 797-908
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000276
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 11 Region: 2014-2118
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000063
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 12 Region: 10108-10372
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000000107
Family Soluble quinoprotein glucose dehydrogenase 0.023
Further Details:      
 
Domain Number 13 Region: 10973-11185
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000000222
Family Soluble quinoprotein glucose dehydrogenase 0.028
Further Details:      
 
Domain Number 14 Region: 4420-4673
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000000379
Family Soluble quinoprotein glucose dehydrogenase 0.031
Further Details:      
 
Domain Number 15 Region: 4131-4401
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000000445
Family Soluble quinoprotein glucose dehydrogenase 0.038
Further Details:      
 
Domain Number 16 Region: 2514-2641
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000000196
Family Soluble quinoprotein glucose dehydrogenase 0.021
Further Details:      
 
Domain Number 17 Region: 1233-1319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000637
Family I set domains 0.0098
Further Details:      
 
Domain Number 18 Region: 7527-7783
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000157
Family SGL-like 0.021
Further Details:      
 
Domain Number 19 Region: 9843-10083
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000183
Family Soluble quinoprotein glucose dehydrogenase 0.021
Further Details:      
 
Domain Number 20 Region: 12331-12514
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000203
Family All0351-like 0.03
Further Details:      
 
Domain Number 21 Region: 11670-11924
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000235
Family Soluble quinoprotein glucose dehydrogenase 0.018
Further Details:      
 
Domain Number 22 Region: 7103-7217
Classification Level Classification E-value
Superfamily vWA-like 0.00000000364
Family Integrin A (or I) domain 0.0087
Further Details:      
 
Domain Number 23 Region: 7885-8053
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000517
Family Serum paraoxonase/arylesterase 1, PON1 0.064
Further Details:      
 
Domain Number 24 Region: 10837-11018
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000981
Family All0351-like 0.079
Further Details:      
 
Domain Number 25 Region: 1531-1582,1870-1924
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000294
Family I set domains 0.035
Further Details:      
 
Domain Number 26 Region: 12105-12337
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000418
Family Soluble quinoprotein glucose dehydrogenase 0.019
Further Details:      
 
Domain Number 27 Region: 13467-13511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.01
Further Details:      
 
Domain Number 28 Region: 3235-3368
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000000536
Family Soluble quinoprotein glucose dehydrogenase 0.029
Further Details:      
 
Domain Number 29 Region: 11536-11702
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000687
Family SGL-like 0.065
Further Details:      
 
Domain Number 30 Region: 712-808
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000825
Family I set domains 0.036
Further Details:      
 
Domain Number 31 Region: 536-635
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000851
Family I set domains 0.01
Further Details:      
 
Domain Number 32 Region: 11233-11408
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000118
Family All0351-like 0.046
Further Details:      
 
Domain Number 33 Region: 10490-10752
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000157
Family SGL-like 0.036
Further Details:      
 
Domain Number 34 Region: 6416-6619
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000209
Family Soluble quinoprotein glucose dehydrogenase 0.021
Further Details:      
 
Domain Number 35 Region: 11991-12148
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000222
Family All0351-like 0.025
Further Details:      
 
Domain Number 36 Region: 8963-9120
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000327
Family Serum paraoxonase/arylesterase 1, PON1 0.08
Further Details:      
 
Domain Number 37 Region: 10389-10538
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000379
Family Soluble quinoprotein glucose dehydrogenase 0.034
Further Details:      
 
Domain Number 38 Region: 5733-5878
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000399
Family Serum paraoxonase/arylesterase 1, PON1 0.098
Further Details:      
 
Domain Number 39 Region: 6137-6367
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000471
Family Soluble quinoprotein glucose dehydrogenase 0.033
Further Details:      
 
Domain Number 40 Region: 6851-7090
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000051
Family Soluble quinoprotein glucose dehydrogenase 0.023
Further Details:      
 
Domain Number 41 Region: 8807-8971
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000556
Family All0351-like 0.084
Further Details:      
 
Domain Number 42 Region: 6723-6898
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000569
Family SGL-like 0.072
Further Details:      
 
Domain Number 43 Region: 3858-4028
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000719
Family All0351-like 0.036
Further Details:      
 
Domain Number 44 Region: 4565-4783,4846-4949
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000811
Family Soluble quinoprotein glucose dehydrogenase 0.029
Further Details:      
 
Domain Number 45 Region: 3699-3854
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000017
Family Soluble quinoprotein glucose dehydrogenase 0.022
Further Details:      
 
Domain Number 46 Region: 9087-9324
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000196
Family Soluble quinoprotein glucose dehydrogenase 0.022
Further Details:      
 
Domain Number 47 Region: 6560-6720
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000235
Family Soluble quinoprotein glucose dehydrogenase 0.023
Further Details:      
 
Domain Number 48 Region: 11389-11506,11537-11571
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000248
Family All0351-like 0.093
Further Details:      
 
Domain Number 49 Region: 5239-5403
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000353
Family Soluble quinoprotein glucose dehydrogenase 0.033
Further Details:      
 
Domain Number 50 Region: 2811-3075
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000615
Family Soluble quinoprotein glucose dehydrogenase 0.029
Further Details:      
 
Domain Number 51 Region: 6022-6183
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000085
Family SGL-like 0.034
Further Details:      
 
Domain Number 52 Region: 8021-8182
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000103
Family Soluble quinoprotein glucose dehydrogenase 0.02
Further Details:      
 
Domain Number 53 Region: 8515-8666
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000157
Family SGL-like 0.025
Further Details:      
 
Domain Number 54 Region: 8622-8771
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000275
Family Soluble quinoprotein glucose dehydrogenase 0.036
Further Details:      
 
Domain Number 55 Region: 2409-2543
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000412
Family Serum paraoxonase/arylesterase 1, PON1 0.079
Further Details:      
 
Domain Number 56 Region: 8166-8334
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000445
Family Soluble quinoprotein glucose dehydrogenase 0.028
Further Details:      
 
Domain Number 57 Region: 4998-5106
Classification Level Classification E-value
Superfamily vWA-like 0.0000482
Family Integrin A (or I) domain 0.014
Further Details:      
 
Domain Number 58 Region: 921-1012
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000577
Family I set domains 0.068
Further Details:      
 
Domain Number 59 Region: 9357-9522
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000654
Family Serum paraoxonase/arylesterase 1, PON1 0.072
Further Details:      
 
Domain Number 60 Region: 2670-2855
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000667
Family Soluble quinoprotein glucose dehydrogenase 0.046
Further Details:      
 
Domain Number 61 Region: 3411-3602
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000719
Family All0351-like 0.087
Further Details:      
 
Domain Number 62 Region: 5384-5407,5436-5684
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.0000772
Family Soluble quinoprotein glucose dehydrogenase 0.036
Further Details:      
 
Weak hits

Sequence:  CBG16558
Domain Number - Region: 9720-9862
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000128
Family All0351-like 0.05
Further Details:      
 
Domain Number - Region: 257-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 13298-13373
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000143
Family Fibronectin type III 0.0061
Further Details:      
 
Domain Number - Region: 3096-3279
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000183
Family SGL-like 0.023
Further Details:      
 
Domain Number - Region: 219-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00186
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number - Region: 5881-6024
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00405
Family SGL-like 0.075
Further Details:      
 
Domain Number - Region: 7012-7114,7325-7464
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0242
Family All0351-like 0.051
Further Details:      
 
Domain Number - Region: 9446-9686
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.0337
Family Cell wall binding repeat 0.021
Further Details:      
 
Domain Number - Region: 8268-8328,8362-8478
Classification Level Classification E-value
Superfamily Cell wall binding repeat 0.051
Family Cell wall binding repeat 0.022
Further Details:      
 
Domain Number - Region: 4043-4162
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0595
Family All0351-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG16558   Protein: CBP25279   Gene: WBGene00036463
Sequence length 13580
Comment CBP25279 WBGene00036463 locus:Cbr-dig-1 status:Predicted UniProt:A8XPH1
Sequence
MGGRNWLIRSAFLVSTFLLCISIAQVGFHLLYSTPNIVKFQELLPSIEVESLAQDLQIQE
WMRTLRRVKRAPTRSNRPEPVVVGRNGTGKCVISADRASHFCGMEEEVSAPPIPPPDEGK
CIISKASGREICYPSYSQLDTSCTDVIEKSSNGLVVPPVVPHATQVLSKLFLTILINFRV
RAMAFVPPDNLRRLIIQYYRQQGKHQPKNATFSPKSFLFVKYHCDYGYEMVDEVDTMFCQ
DKQWVLTPPMCRGQGLCAADNGGCSHTCISYNDEKIECKCPRGMTLDVDEKTCIKPVPKS
LCRSLSGCTCNGVTETQFACSCGDNKQKCLLLTGPPKIYIEPQGPYEVAPGGNINISCTS
VAYPFPDIYWYKNQRVNTNGQGQNILRSSQVLIIKEIYRNEEFTCVADNIHGSANRTVSI
VVTGPGSAPNLKSASAGRTSLTVRWEPPSIINRPITTYTLYYTNNPQQPVKNWKKLEVKE
PTREVAIPDLRPDTAYYIRVRANDQLGPGKLGNQVQIRTLKPAVRPYVTIVEGDEIRVPP
MTPFELDCNVTKADPIPVLVWLHKGRSLNKGSKTQHIKMKNGGVLESTQFSCVAENEAGK
STKKINITVTGPSAPERIRYQIDGDKVTLQWEPPQITNGPMAGYDVYYTDDPSLPRDQWK
VHHIDDPNARTTTVPRLNEKTPYNFFIVGRNRLGPGLRSSPFTATTWLASKPPIVLLEPQ
DEVTKEPSNDEMIIECGAQGVPKPKIIWLWSGTLIEDGKDEFRVYDTTPADAQDRTRSKL
IAQSTTRSGVATCQAVNSEGSDEKKVPVKILGPGSAPIGITPTPMHTGFDVAWQPPKIPN
GRIKDYVVYYSKDPDAPLSDWESRTVLADTRNLTIHVDDEDTPYVTKVQARTDDGPGIIS
EAYEVTTGRKQVPLSVRLEVTDPSVDPSSGETVVEPTQPIHFRCIADGRPMPSVSYSWLP
SNASESGDEPVPIPIQTDENQPHRYNSIQVYSTTATKRVLLCQARNPDGTVDDRHVFIVN
KPGSAPQNVEVIVDPDNRVTITWQPSKYPNGDITKYNVYITGDPSLPVDQWQVFPVDEVT
DPKLVLQRGALQPETPYYVKIAAVNPHGEGIHTDAKHFDTVSGAPIDAPTDVLPSVSIDN
TVNVTWSPPTQPLGPIKSYTVFFAPEYDDSDYKTWQRISVDAPDGADHGEITLPKEQFNP
NTPYKIRVSSTNDLSEGPASEPFRFETGSGEIPPTITLEPSNSTYLVEPLGAVTITCTAN
GVPQPKVHWIKENGEHVDSATLQLYDVVKDSSATCVAENNAGKTQEAVTVQVTGPGTAPN
EIVLLPMPNQEINVEWTSPDEVNGQITNYIIHYGEIAEDGSEPTTWDQITIPRDDVNHKL
ANLEPKKTYAVRVQAVSDRGPGVISAPQVIKTLPLAPQAITNPIIQVHPNNSVTIEFTPP
DDPENPGKKIKDFVIQYTTDEEPDDESEWKELKFSDPDDTDDTTFVNIDGENFNPDTKYN
TRIIARGEIDSQPSDTTLFATGDGVIAPSQPTFNVETEDGVIRVPAGTDYTIKCVSDGYP
APDIRWVDSHGNQLSDGPLLRIIDIRKTLNAKCLAENRGGLKETDLIVFVAGPGTAPENI
QLTANKPTTISVQYEVPSIPNGNISKYIIYYTPLDDQDPNHQLGQVQTKPINEWLNVHDL
NDGVEGPRKVDIKDFVNTDTAYAVVVQAINDDGPGPYSNQYTIRTMSRAREGPPVELRVE
PDGQRSAVAQWKEPTTSDVPPIGYEIYYVRGDKSVEEDDSAGLNDWIKISIDDPSKLTHK
IQNLLLPDTDYVFKMRAIYPDGPSVFSEPCIMKTLPDGSAPYIQISTGDNGVEGSTTINI
LPGSQMTIACNATGVPLPQVKWIKAGNYEIDPSRVDADKNHAQFSLQVGNITEDTTFNCV
AQNPWVMRTGLSIDDFVTSKSDGGQIVLVFNDELPEYLKPPNEWTIQYTDDAEQPKDQWE
TIPSGGAPLTRVEVLNMNPGTYYYLVVDNPEKGIQTPTLVVMTPKPPSDIRFGKNNDDEQ
VVDFKPAITSEPVKEYTISVWPSSDPTNVKKFTTPADVTSGVVVDGLDPDTEYNIQVAAE
FFEGEEIASEPITVKTPPRDVSCECEHACTFELNEDDGTLEPKCYCHDGFHLTSDGKGCE
RDEEDDATSQAVLQVTPPSITTKVAPEELPTGEPETTSGTISPIVGPDGKPLPVDNKGRP
IDSAGKRIEIYENGDPVAPDGTTLEKNDKGEWIYPLVDKNGKPLPVDENNKPIITAVDEK
GDPLIESEDGAFVTSDGKPVEVDILGRPLDKDGNPYKTNENGQFVVADVDGADMEEEDDE
KPPVIPFYIIEVDDDGKYLDEEGNELPLNEDGEPVDEDGNKLEKNGEGKYVKPKKAEDTP
QPTKITIVSPDGTPLPTDANGSPIGLDGHPIPTDSSGRPLAKDGSPLPTDNQGNYVILPA
SRDEDQAPATDEAGRVIYPILLPDGTLLATDSSGNYVNRHGDIVEKDDDGTPMGPDGQVL
PTDASGNYVYPVTGPNGEVLPTDSNGKPIYPVRGPDGTPLPTDASGAIIGPDGEPIPTDA
SGKPLSKDGSPLPVDNRGNYVVLSTESDVTKTLPTDEAGMPVHPIVKPDGTLLATDSSNN
FITENGDIIEKDEEGRPLGPDGQVIQNLSNILPTDATGNYIYPADGPDGQVLPTDSTGKT
VYPVRGPDGTPLPTDASGAVVGPDGEPISTDSSGIPLDKDGSPLPTDASGNYVLIPTDEP
VTKSYPTDDSGVTVYPIVKPDGTPFETDSTGVFVTDDGQAIEKDSDGKPLGPDGQVLPTD
ASGNYIYPSIGPDEQPVPTDSLEKSVHTVRGPDGTPLPTDASGAVIGPDGEAIPTDGEGA
PLNKDGSQLPTDNNGNYVLVPIGEDDFKTVPTDESGNVIYPIVKPDGTLLSTDSTGNYLT
DAGEVVEKDDNGKPLGPDGSVLPTDASGNYVYPAASESQVFPTDAYGKPIPTIIGPDGTL
LPTDGLGSVVGPDGVPIITDQTGTPLDKDGAPLPTDDSGNYVFITTQHPTDEVVTPITKP
DGTPLATDSIGNYVNDNGDIIEKDNEGRPLGPDGTVLPTDDSGNYIYPATTIDGELLPTD
SAGKTIYPVRGPDGTPLPTDASGIPVRPDGEPIPTDENGTPLAKDGSPLPTDNNGNYIYV
PDDVETKELPTEEVDHVVHPIVNPDGTPLGTDSSGNDVTFTGEVIQKDDDGKPLGPDGSV
LPTDDSGNYIYAVVGPDGQVLATDDSGKPIYPVRGPDGTPLPTDASGAVIGPDGEPVPTD
ASGKPLSKDGSPLPTDASGNYVLIPTEEDTTKTLPTDEAGLVIYPIVNPDGTPLATDSTG
AFVTQDGSTIDKDEDGKPLGPDGSVLPTDNSGNYIYPVIGPDGQPLPTDSSGNPIYPVRG
PDGTPLPTDSKGNVIGPDGEPIPTDASGKPVAKDGSPLPTDNQGNYVLVPTVGEVTKALP
TDDAGNVIYPIVMPDGTLLTTDSTGEYVTDNGQIIEKDDEGKPLGPDGQVSETLLNVFFI
LPTDATGNYIYPADGPDGQVLPTDSTGKTVYPVRGPDGTPLPTDAFGAVVGPDGEPISTD
ASGIPLDKDGSPLPTDASGNYVLIPTDETVTKSYATDDSGVTVYPIVKPDGTPLATDSTG
AFVTDDGKTIEKDSDGKPLGPDGQAIKRIIPKDYKKVTLQNLPTDDIGNYIYPAVGPDGQ
VLPTDASGKPIYSVRGSDGTPLPTDSEGNVGPDGEPIPTDASGKPLSKDGSTLPTDASGN
YVLIPTEEETTKALPTDSVGNVIYPIIKPDGTPLATDSYGSHVTDEGHVIEKDDEGNPVG
PDGSVLPTDESGNYIYPAVGPDGQVLATDSTGKTVYPVRGPDDTPLPTDASGAVIGPDGE
PIPTDASGKPLSKDGSPLPTDNQGNYVFVPSDEDTTKVLPTDDSGNTIFPIVKPDGTPLS
TDSTGNFITENGEIIERDDNGKPMGPDGQVLATDDSGNYVYPESGTVEQVLPTDVSRKPV
HQVIGPDGFPLPTDSAGNVIGLDGEPIPTDSDGVPLSNIGLPLPTNSDGEYITLPSDSGE
TKAKPMDDEENDVYPITTADGTPLATDSTGSFVTDDGKIVEKDDDGKPIGPDGQVLPTDD
SGNYVYPAVRPDGQVLATDDSGKSIYPILGPDGTPLPTDASGAAIGPDGEVIPTDASGKP
LSKDGSSLPTDASGNYVLIPTEEDTTKALPTDEAGLVIYPIVNPDGTPLATDSTGAFVTQ
DGSTIDKDEDGKPLGPDGSVLPTDNSGNYIYPVIGPDGQPLPTDASGNQIYPVRGPDGTP
LPTDSDGNVIGPDGEPISTDASGKPLAKDGSPLPTDNNGHYILVPTGDDTTKALPTDSEG
NVVYPITKPDGTPLGTDSTGKFITEEGQVVEIDEEGKPVGPDGAVLPTDASGNYIYPAVG
PDGQVLPTDSTGKTVYPVRGPDGTPLPTDASGVVIGPDGEPIVTDSSGIPLDKDGAPLPT
DASGNYVLVPAGEEVTQALPIDVSEVVISPIIMPDGTLLGTDSTGAYVTNDGQIIEKDDE
GKPIGPDGKVLPTDASGNFIYPVVGPDGQVLPTDASGKPVHPVRGPDETPLPTDSEGNVI
GPNGEPIPTDASGKPLSKDGSPLPTDNNGNYILVPSDEEVTKALPTDDSGNVIYPITKPN
GSPLPTDTNGVFVTENGDVIEKDEDGKPLGPDGEVLPTDASGNYIYPENGPDGQPLPTDS
EGQNVEPESPSSSPDSQMLPTDASGKTIYPVHGPDGLPLPTDESGAAIRPDGELIPTDES
GTPLADDGSPLPTDDAGHFIFVPSPEIATTPEDAGPSYIIRPVVRPDGTPLSTDSTGTYI
TDDGEVIERDDERKPLGPDGSVLPTDDEGNYIFVTSEQPTEETALVATHTPITKPDGTIL
GTDSSGHFLTENGDIIANDNQGRPIDIDGQVLPTDASGNYVYAEKTTQGDTVFIPTEVVP
IAHEEPNCDKVDGRVETLLLVVESSHTSAPYLDTLKKLIKNLLLTTPREFLPKIGTIIYS
GSSEITVDIGDYADFKELYDSTNEIREISGTPDMTNALFTARNVLSGINRGETVVIHFSA
SPMRTSSKANTDRLRALPKTRLVHLDEQQWANDPNAVDLLRSYLCIPTDGEFSDSKFSMK
LLFFSVPSPSMLPTDASGNLIDVSTEAPVTDGPPTDAAGFVIYPIVRPDGTPLATDSTGV
FVTDDGTVIEKDDEGKPIGPDGEVLPTDASGNYIYPIIGPDGQPLPTDSNGNPIYPVRGP
GGTPLPTDASGAVIGPDGEPIPTDSSGKPLAKDGSPLPVDNQGNYVLIATEETVRESYAT
DETGNVIYPIINADGSPVPTDSEGNYITASGEVIERNEEGKPLGPDGSVLPTDASGNFVH
PADSEESATETPIITHGPDGQVSFFVMTVSISVFLKVLPTDASGKPIYPVRGPDGTPLPT
DASGAVIGPDGEPIVTDSSGIPLDKGGAPLPTDASGNYVLVPTEDTTKTAPTNSEGNVVY
PITKPDGTSLGTDSTGSFVTDDGQTIERDEDGKPLGPDGQVLPTDNSGNYIYPSTTPNEQ
TLPTEGAFTHYEVRGPDGTPLPTDESGNVLDLDGERIPTDSTSGIPLSKDGSPLPPDNDG
KYILVPTEETIRKILPTDETKEETVYPVVQPDGTPMGTDSTGNYVTTTGEIIEKDGEGKP
LGPDGSVLPTDGSGNYIYPAIGPDGEPLATDASGKTVYPVHGSDGSPLPTDASGAVIGPD
GEPIPTDASGKPLAKDGSPLPTDASGNYVLIPSDEETTKALPTDDSGNVIYPITRPDGTL
LGTDSSGNFVADDGQIVERDESGKPMGPDGQVLPTDDSGNYIYPAVGPDGQTLANVSTIQ
HVYSVHGSDGSPLPTDASGAVIGPDGEPISTDASGIPLDKDGSPLPTDASGNYILVPAGE
DVVKTPPTDGNGVIIYPIVQPDGTPLKTNSDGNYVTATGDVIERDEEGKPLGPDGSLLPT
DDSGNYIYPAVGPDGQPLATDSTGKTVYPVRGPDGTPLPTDASGAVIGRDGKPIPTDADG
KPLGKDGSPLPTDNQGNYVLVPTDEDTIETLPTDESGNVIYPITKPDGTPLGTDSTGKLV
TDDGQVVEIDDEGKPVGPDGAVLPTDAAGNYIYPFVGPDGQVLPTDASGKPVYPVRGPDG
TPLPTDSEGNVIGPDGEPIPTDASGKPLSKDGSPLPTDDNGNYVLVPTGGDVTESLPTDD
SGNVIYPITRPDGTPLATDSSGNFIADDGQIVEKDESGKPMDPDGQVLPTDSSGAYIYPQ
ILTDEASTLKPSYPVHGSDGTPLTTDAYGAVIGPDGEPIPTDASGIPLDRDGSPLPTDDE
GNYIYVATDIPTEETTDSPIVITRPDGTPLGTDSTGNFITENADIIEKDDEGKPIGPDGQ
VLSTDSTGNYIYPVIGPDGQVLPTDSTGKTVYPVRGPDGTTLPTDASGAVIGPDGEPIPT
DASGKPLSQDGFPLPTDNQGNYVLVPTGEDVTKSLPTDDSGNVIYPITRPDGTPLGTDAS
GNYVTDEGETIDKNEDGKSIGPDGQILPTDATGNYIYPVVGPDGQVLPTDASGKPMYPVR
GSDGTPLPTDSDGNVIGLDGEAIATDSSGKPLSKDGSPLPTDTSGNYVLVPTDEETIKTL
PTDDSGNVIHPVTRPDGTPLGTDSTGVFVTDDGQVVEKDEDGKPIGPDGSVLPTDDSGNY
IYPAVDPDGQVLPTDASRKPIYPVHGADGTPLPTDSDGNVIGPDGEPIPTDASGKPLAKD
GSSLPTDASGNFVLVPSDEVTTKVLPTDSEGAEVYPVINPDGTPLATDSTGKFVTEDGQI
IETDEEGKPVGPDGQVLPTDASGNYIYPVVGPDGQVLPTDSNGNPIYPVFGPDGTPLLTD
ATGAVIGPDGEPIPTDESGKPLSKDGSPLPTDNNGNYVLVPTGEDTTKDLPTDSAGNVVY
PITKPDGTSLGTDSTGKFITEEGQVVEIDDEGKPVGPDGAVLPTDASGNYIYPAVGPDGQ
GLPTDSTGKTVYPVHGPDGTPLPADGSGAVIGPDGEPISTDASGVPLDKDGSPLPTDNQG
NYVILPSDDKKGPTKCDIAHSLSDVIFVLVNDGDGSQNYEQFRKTVVGFSKKVDMSPDVV
RLAVLSVGSEIAVPLPLGGYQEKEHLNSILASFQLPPTIGTEILSPVEAANQQFSSFPRT
GISKMVVIFADNEERTTQIGGATYVTVKYGTTPKEIIGTLTEACQKGTVDIVPDDTKQVI
DNTVHSTSSTPVIVDQSGKPLPTDATGNYLDNNGNPIVIESNEPTGPEDQKLSKNEKGEW
IYPLVDKSGKPIATDENDKPVITVIDNDGNELSKNDDGNWIDLSGNEIDTDELGRPLDSE
GKPYEFDNDGRVVIVPEVEEDATPAIPFIIVDGEPINEIDGQYTDSDGNVIETNSDGLPI
DENGQVLPKNQDGEYVKPKTVGTTQASIVSPDGTPLPTDASGSVIGLDGAPILTDSSGKP
LAKDGSPLPTDNQGRYVLVPASKDTFDSTLPTDSAGNVIHPVVNPDGTLLSTDSSGNFIT
QTGDIIERDDEGKPVGPDGSALPTDASGNYIYPVVGPDGQVLPTDSNGNPIYPVFGPDGT
PLTTDASGVVIGPDGEPVPTDSSGKPLAKDGSPLPKDASGNYVLVSTDEDTTKALPTDEA
GNLIYPITRPDGSLFGTDSTSEHITDDGQLIEKDEDGKPIGPDGSVLPTDASGNYVYPAV
GSDGRVLPTDASGKPIYPVRGPDGSPLPTGASGAAIGPDGEPIQTDANGKPLAKDGSPLP
TDVSGNFVIVSSDEVLTKSAPTDSEGNVIYPITNLDGTPLGTDSSGAFVTQDGTVIEKNE
DGKPVGPDGQVSDYTFSIIEVLPTDDSGNYIYPAIGPDGQVLATDASGKPIYPVRGPDGT
PLPTDASGAVIGPDGEPIPTDESGKPLSKDGSPLPTDNNGNYILVPRGDDTTKTLPTDSE
GNVVYPITKPDGIPLRTDSTGKFITEEGKVVEIDEEGKPVGPDGQVLPTDASGNYIYPVV
GPDGQVLPTDSTGKTVYPVRGSDGTPLPTDASGAVIGSDGEPIPTDASGKPLSQNGSPLP
TDNNGNYVLVPTGEDVTKALPTDDSGNVIYPITRPDGTPLGTDASGNFVTDEGESIDKNE
EGKPIGPDGQILPTDADGNYIYPAVGPDGQALPTDTFGKTVYPVHGSDGTPLSTDASGAV
IGPDGESIPTDASGKPLSKDGSPLPTDASGNYVLIPTEEDTTKTLPTDDSGIVIYPITRP
DGTPLGTDSTGAYVTDDDQVIEKNEDGKPFGPDGQVLPTDASGNYIYPVTGSDGQVLPTD
SGLPVIVDQSGKPLPTDKLSKNEKGEWVYPLVDKSGKPIATDENDKPVITVIDNDGNELS
KNDDGNWIDLSGNEIDTDELGRPLDSEGKPYEFDNDGRVVIVPEVEEDATPAIPFIIVDG
EPINEIDGQYTDSDGNVIETNSDGLPIDENGQVLPKNQDGEFVKPKTVGTTQASIVSPDG
TPLPTDASGSVIGLDGEPIPTNSNGKPLAKDGSPLPTDNQGRYVLVPSDDSTTKTLPTDE
TGNTIFPITRPDGTLLATDSTGEHVTDDGQVIEKDEEGKPIGPDGSVLPTDASGHYIYPA
VGPDGQVLPTDASGKPIYPVRGPDGAPLPTDSEGNIIGPDGEPFPTDASGKPLSKDGSPF
PTDASGNYILVPAEEETTKTLPTDSEGNLVYPITRPDGTPLGTDSTGAFVTQDGSVIEKD
EDGKPVGPDGQVIEKFSTAVPKKQESPRQFHSQTITKYLIQVLPTDDSGNYIYPVVGPDG
QVLPTDSTGKTVHPVRGPDGTPLPTDASGAVIGPDGEPIPTDASGKPLSQDGSPLPTDNE
GNYVLVPTEDDSAKALPTDDSGNVIYPITRPDGTPLGTDASGNFVTDEGESIDKNEDGKP
TGPDGQVLPTDADGNYIYPAVGPDGQVLPTDDSGKPVYPVHRSDGAPLPTDASGAVIGPD
GEPIPTDASGKPLAKDGSPLLTDASGNYILVPSDEETPKALPTDSEGNVVYPITNPDGTP
LGTDSSGAYVSQDGSVIEKIEDGKPVGPDGQVLPTDASGNYIYPVVGPDGQVLPTDATGK
TVYPVRGPDGTPLPTDGSGAVIGPDGEPIPTDPSGKPLSKDGSPLPTDASGNYILVPAEE
ETTKTLPTDSEGNVIYPITNPDGTPLGTDSSGAFVTQDGTVIEKNEDGKPVGPDGQHVYP
VRGPDGTPLPTDASGAVIGPDGEPIPTDASGKPLSQDGSPLPTDNQGNYVLVPTGEDVTK
YLPTDESGNVIYPITRPDGTPLGTDASGNFVTDDGTVVEKDDEGKPVGPDGAVLPTDADG
NYIYPAVGPDGQVLPTDASGKTVYPVHGSDGTPLPTDASGAVIGPDGEPIPTDASGKPLS
KDGSPLPTDASGNYVLIPTEEDTTKTLPTDDSGIVIYPITRPDGTPLGTDSTGAYVTDDD
QVIEKNEDGKPLGPDGQVLPTDASGNYIYPVTGSDGQVLPTDAGLPVIVDQSGKPLLTDA
TGNYLDNNGNPIVIESNEPTGPEDQKLSKNEKGEWVYPLVDKSGKPIATDENDKPVITVI
DNDGNELSKNDDGNWIDLSGNEIDTDELGRPLDSEGKPYEFDNDGRVVIVPEVEEDATPA
IPFIIVDGEPINEIDGQYTDSDGNVIETNSDGLPIDENGQVLPKNQDGEFVKPKTVGTTQ
ASIVSPDGTPLPTDASGSVIGLDGAPIPTDSSGKPLAKDGSPLPTDNQGRYVLVPSDDST
TKVLPTDETGNTIFPITRPDGTLLATDSTGEHVTDNGQVIEKDEEGKPIGPDGSVLPTDA
SGKYIYPAVGPDGQVLPTDASGKRIYPVHGADGTPLSTDSEGNIIAPDGEPIPTDASGKP
LAKEGSPLPTDASGNYILVPSDEETTKALPTDSEGNVIFPITNPDGTPLATDSSGVFVTQ
DGSVIEKNEDGKPVGPDGQVLPTDASGNYIYATDGDKQINPTDASGNLIYPIIAPDGSVI
EGPEKPAEPVGPDGKVLPTDDEGYFIDMDGQRLPTDSVGLVVYPVTNPDGSPVGTDSIGA
YVTQDGKVIEKNEDGKPVGPDGQVLPTDESGNFIYPVIGPDGQVLATDSTGKTVYPVRDP
DGTPIPTDASGAVIGPDGEPIPTDTSGKPLSQDGSPRPTDNQENYVLVPTGDDVTKTLPT
DGEGNIIYPITRPDGSLLGTDSTGKFITDDGIRVEVDDEGKPVGPDGSVLPTDASGNYIY
PAIGPDGQVVPTDASGKPIYPVRGPDGTPLPTDYKGNVIGPDGEPIPTDTSGKPLSKDGS
PLPTDNQGNYVLVPIGEDVTEALPTDEAGNIIYPIVKPDGKLLATDTTGAFVTDDGEIIE
RDEEGKPVGPDGSVLPTDASGNYIYPAVGPDGQVLPTDGTGKHVYPVRGPDGTPLPTDAS
GAVIGPDGEPIPTDASGKPLSKDGSPLPTDASGNYILVPAEEETAKALPTDSEGNVIYPI
TNPDGTPLGTDSSGAFVTQDGSVIEQNEDGKPVGPDGQVGFHVLPTDDSGNYIYPVVGPD
GQVLPTDSTGKTVHPVSGPDGSPLSTDASGAVIGPDGEPIPTDPSGKPLSKDGSPLPTDA
SGNYILVPADESTTKVLPTDGDGNVIYPITKPDGTPLGTDSDELFISENGDVIGRDNEGR
PLGPDGQVLPTDASGHYLYSITGPDGQILPTDASGKPIYPVFNEDGTQLPTDSTGFAIGP
DGQFVATDSTSGVPLAKDGSPLSTDATGHFVLVPSGTFTKDSLPTGDADVLPSIKKPDGT
PLGTDSSGEFVTDDGTVVEKDDEGKPIGPDGAVLPTDDSGNYIYSAIGPDGQVLPTDASG
KPIYPVRGPDGTPLSTDASGAVIGPDGEPIPTDTSGKPLSQDGSPLPTDIQGNYVLVPTG
EYVTKSLPTDSEGNVVYPITRPDGTPLGTDSTGKFVADDGKIVEVDDEGKPVGPDGSILP
TDASGNYIYPVVGPDGQVLPTDASGKPIYPVRGPDGTPLPTDSEGNVIGPDGKLIPTDSS
GKPLSKDGSPLPTDNNGNYVLGSSVEDTTKALPTDESGNIIYPIVRPDGTLLPTDSTGAF
LTEDGEFIERDDEGKPIGPDGQILPTDASGNYIYPAASSDGQVLPTDDEGEVIYPITSPD
GTPLATDSTGRFVNEDRQVIERDDTGKPVGPDGQVSVSFFCSNFFIKRRTMLSDMFKTYI
SLKLQVLRTDAFGNYIYPAVAPDGQLLATDASGKPIYPVRGPDGTLLPTDSEGNVIGPDG
EPIPTDASGKPLSKDWSILPTDNNGNYILVPTGEDVTKTLPTDSEGNVAYPITKPNGTPL
GTDSTGKFITEEGQVVQIDEEGKPVGPDGQVLPTDASGNYIYPAIGPDGQVLPTDSTGKT
VYPVRGPDGTPLPTNASGAVIGPDGEPIPTDASGKPLAKDGSPLPTDNDGNYILVSSDES
TTKVLPTDSEGNVIYPITMPDGTPLVTDSTGEYLTEDGQAIVRDDTGKPLGPDGQVISET
LKKLMSEFKVLPTDASGNYIYPVVGPDGQVLPTDSTGKTVYPVRGPDGTPLSTDASGAVI
GPDGEPIPTDASGKPLSEDGSVLPTDNNGNYILVPSDEATSKILPTDEDGNVIYPITRPD
GTPLGTDSTGAFITQDGTNIEKDEEGKPVGPDGQVLPTDESGNYIYPVIGPDGQVLPTDA
TGKTVYPVRGPDGTPLPTDASGAAIGPDGEPIPTDSSGKPLSKDGSPLPTDNNGNYILVP
SVEDKTGVYPTDASGYVIYPIVRPDGTLLGTDSTGAHITDDGEMIERNEEGRPVGPDGET
LSADAAGNYIYPAVGPDGQVLSTDASGKPIYPVRGPDGTPLPTDSKGTVIGPNGEPIPTD
SSGKPLSKDGSPLPTDNNGNYILVPTGDETTKTYPTDSDGNFIYPITKPDGTPLGTDSSG
AFIAQDGSVIEKNKDGKPVGPDGQVLPTDESGNYIYPITGPDGQVLPTDGSGKSIYLVHG
PDGTPLPTDEIGSAIGPDGELVPTDSSGKPLSKDGSPLPTDNNGKYIYVVSDESTTKILP
TDETGNVLHHVTRADGTLLGTDASGDYVTDNGQVVQKDDEGKPIGPDGQVLPTDDSGSYI
YPITGPDGQVLPTDASGKPVYPVFNEDGTQLPTDPTGFAIGPDGELVTTDSTSGIPLAKD
GSPLPTNASGQFVIVPAKDTTKALPTDENGLIIYPITRPNGTLLSTDSTGSFLTDDGKLI
DKDSEGKPLGPDGSVLPTSSSGNYIYPAVGPDGQILPTDTSGNVIYPIFYPDGTPLGTDS
TGSFITEDGEVVGKDSEGKPVGPDNQVLPTDGSGKYIYPAIEPDGEILPTDASGKSIHPV
YTPDGTKLPTDASGSAIDPDGQLVPTDASGKPLGKDGSVLPTDNNGRFVLVHGDGVVTKT
VPTDESGKTIYPITRPDGSLLSTDSTGIFLTDDGHVIDRDEEGKPLGPDGQILPTDGYGN
FVYPAESDIGGAKLLPTDEYGHTIFPVIRPDGSLLSTESSGSFVTDDGKLVSKDGQGKPL
GPDGQVLPTDSAGNYIYPSIGPDGSPLPTDVNRKPVYTVIGRYGDVLPTDSEGRSVNIDG
SVVPTDESGLPIDQYGMVLPTDTTRKLHTLVPTRRPSEYCYVTSHIDLLLVIDSSNNIKV
LDYRVMKELIKNFLTEHFNLRKHQVRVGLVKYGDGSEIPISLGDYDNEDDLVHRISESRR
LKGRAQLGAGLREALDELSISGVDGVPQIVLVVKNGKASDDYSSAVKSLKSERNVTIFVV
DSGDDESQDQNSELTDADKIVVIPQWRGADSEVLGPIADYICKIVPNVESARTWPTPRTK
ATTLAGSRRSCSTIDYESDVIIVLDSSENFTPDEFDSMKDAVASIVDTGFDLAPDVSKIG
FVIYSDKVAVPVALGHYEDKIELLEKIVDAEKINDGVAIALYGLNAARQQFQLHGRENAT
KIVLLITNGKNRGNAAAAAEDLRDMYGVQLFAVAVGSNPDELATIKRLVGNANPDNAIEV
AQSTEIDDNAVGILKAVCGNTAPKNSEMPAHLTTKRDLGSQKYTTAPMLRTTRAVSGGLC
NDGIRRPYHINILVDITSRASSEEFERVLDHLVNFFNDRLRDEQHMITINIITVNSEKVQ
KISNSLRVDQLADELNTIKQQAEDSVSPKLGAGIDALVELSRENYINGAVKLMIIVSSDG
TSSDDALPASEYANGDFQHNIIAISVRKPATDLLSKVAGLPTRVIHLDQWSAPNELFDSW
IAYITCDYATASTTRKSTTPKMTTLLPFGRDASKEDATNIELIPLSPSSISVSWTCCTNN
KSNYTILYTHDTSIPKKKWLRKEATCRDSFGTHLDNLPSDHTYTICVMTTERVENSTALA
IDKNCDRIHIDLNTTAPENYVKPSPTSCNCQCSSEGKAVLRATCEMVIDTNRPIATLPPA
TVDECPCKVKAHGGRCPKGYIAKDGQCYDIDECATNNGQCSEGCVNTPGAYYCACPHGMM
RDPLDPFNCVNTANSFDKIAALLANYLEANTKNKDSEVTSEKSGGRVNYKATIKSADDKT
ITFEWSHVPEVVRRAFKWLF
Download sequence
Identical sequences A8XPH1
6238.CBG16558 CBG16558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]