SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG16888 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG16888
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 213-314
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000362
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 106-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000195
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG16888   Protein: CBP03958   Gene: WBGene00036697
Sequence length 324
Comment CBP03958 WBGene00036697 locus:Cbr-dim-1 status:Predicted UniProt:A8XQ02
Sequence
MPDGKAPHFPQQPVARQNDDGSLELECFVDANPTPQVKWYYDNKEVENSGRFSANLANKG
SDSYSAILTIKELADADAGAYRCAIVNPHGKGNANFNLKLTGFSSPTFVEKPQISSRDDG
QVMVMEFRAKSILEPTFVWQKLVGGGAEEIIANSDRIKAVKKLEAGNVYYSALEIKEPTK
DKDAGQFICTVKNESGKLTATFTVKFEVPEGAPSFTRKPQILQQTSSGGEPAICFDIGYS
ARMNPQVTWISPKSKKMKESSRIKFKTNDEGNGNFTAQLELTNYKAKDSGTYTCNIKNDA
GEANVELTLNIEGPLDDYADDSEN
Download sequence
Identical sequences A0A261CR14 A0A2G5SW76 A8XQ02 E3LC84
XP_002645170.1.8413 XP_003118462.1.11157 31234.CRE00002 6238.CBG16888 CRE00002 CBG16888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]