SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17003 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG17003
Domain Number - Region: 97-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0309
Family LDL receptor-like module 0.0082
Further Details:      
 
Domain Number - Region: 24-88
Classification Level Classification E-value
Superfamily Variant surface glycoprotein (N-terminal domain) 0.034
Family Variant surface glycoprotein (N-terminal domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17003   Protein: CBP10421   Gene: WBGene00036783
Sequence length 192
Comment CBP10421 WBGene00036783 status:Predicted UniProt:A8XQ88
Sequence
MHFLNLVLIGTILVAGAHGASVAGKVCTEADKMMAVSCGLRLIDFAGKAQNLDIEDDDEM
AEFHRGCEALSDCNKTLNHCPLFNDADAVDAFGNVKNYCSIIKFVVDDFADCERKLDEKN
LSCYEDWSPFYNYVEMKDPKKVQDVCKNFFGKRNCLKKEVTEACGKGHWEKLKNNLLYLN
ENAKKCDFKGII
Download sequence
Identical sequences A8XQ88
CBG17003 6238.CBG17003 XP_002648875.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]