SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17392 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17392
Domain Number 1 Region: 1239-1432
Classification Level Classification E-value
Superfamily Fibronectin type III 2.03e-20
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 704-836
Classification Level Classification E-value
Superfamily Fibronectin type III 7.96e-18
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 3 Region: 1046-1227
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000543
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 4 Region: 846-940
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000225
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17392   Protein: CBP36434   Gene: WBGene00037031
Sequence length 1745
Comment CBP36434 WBGene00037031 status:Predicted UniProt:A8XQY7
Sequence
MSKNGSSDPTTDKRERIRQEFFRNILKGSGLSGRIGSMDTSDDGGSTSSRQTPPEYPSPT
PPSNSPPITSASLEAESPIGDEYSNENDVDDRCASSGEEKVNMSGLCTEDEEDGDPEILD
KMKDWIVQQGYNMIPFDKSIKLGAGMVFVHVIDTTLRVELGDNEIVLDGYGSILMMGKPG
QYIRPFPFHVPHGIGCYQFADGNEVSTLSYCSSILNGVRLTHIVFASAHLNRVFNPMNVP
TLRCLPAPTNHDQDAPSGSDEESRRNGDRNNNGSGSDEQNFEKNENHGNAQGRSDYGNRN
SGRERSNGQVEEQENGQTGGQSEGQSNEPVEQAASGPSQDYRNHGHQHNGQDYRRHGNGH
FHNGQGNRQQHGNGNQNNRGGRKPRGNGHRQHDFLAPRDNHGQQRNGGQNGYNCHREVQN
GNGHHNGHRGHHVQNGNHNGYNQGRNGSRRGEHHRNHQRGWQGHQGESSSNNGYFENIQQ
FPPLPSQDQGQVMMVAPQEINQWESGHQGPVVDEAPMTLQRAQFPSPDAPEFHPQGFVHE
MQMDDQMVQIPNEMMVAQPMMNGGMPMQGMVPNGAMVPVTHGHMQMQPMMPPVDVHGNPI
YSVPPPQPGMIIDGNQYHNNWNVHYPHLIHVDVPEEALVMKQPTQQDTHPAYMMFGFDPV
DVNGFLRSIGLTNFIQIDDSEIQYHATVKNQEELPSKSFLVEIMRERSQTGQLLFEVFSL
QPNTRYTITMCARMDARKLRGPPTKPFEFRTAPGRPDPPKDLRNIHRGLHYIKVAWKAGN
NNGSLILYYHLELFADGCSEGQLIESKEDTVEILNLKEHTAYEARITAFTALGESLVGLN
RRLFTKGVGQPKKARNLCVFPVSHRSFAITWDEDPTNYYDLEMYNCSTNVSKVVRKDLGS
YRTTVGELPPSTLFHFRVKSVNNDGECWSEVREATTQRDFNGTMVHNGRTVPIPHPASKP
EFVGFVDGCPKMSWGNQNSDGSIYTVQGATKEDPNKYINMYQGPETSIVVLDTAIRYMQV
LRTTHDGIRCDKSVRGDVTRDSISLRPDRVQDVKLFFVRQGVLLVQWTPFDTEKMFIPNG
GKIVYYVQRRFANTNSHYIAFFDESDQCELENIPGETEVTVYIRAAIHVDDSSVNGDWSL
PARIITPRSPPVAVHNVKFDSNSRLLSWESFDQCADLQFSVNIIHTESKRSIMKLVTTSR
NVIVEGLQPGDEFSAIINATTNVGKSPVVAKDFSIPALRPSTPVNPIVQKVKTNEVTVAF
KASEPNGSPVTGYIIRLMLNGEFFQEDFVRPEEVEINGTFKHKFQELKANTNYTVSIAAK
NAAGISCKVEVPVQTRSEPPVAPTIQCRPDAYQLRLSWDDTPANEDLTYKLSRFNPENQQ
SSTVYQGDDRVKIVKNLKEDTKYFFTLVVTNKISGAFATSRQTEFRTKIAPPPTIKRTPI
IVLKAGETHTYLVEWEDHLPEQPQYDQVYWLQVSDATIDRAPWVTVYSGKRPSYEVDTKD
FSGALHVRVLCYRSETMKGSPSPVGYISNIPPEVPREEVTKNVHFMKVNKYFQEPNEAGT
PLWQQALAQWFRDLPASVVTVIIMCIFVIFSVSFTESPMLDYPYKYTGAYMVSKLNFGLQ
PQFQDKRMIFCSFTNIFRANTDIEKVPLVANEEIMEHAKEKKTVYQRMPENEQSKIPKPS
PYRELEMMMNSNEKHTNGAVIGLGTLGFAYALVAIPILPYEDRILNLYGIKGKSDDQSEP
GSPAK
Download sequence
Identical sequences A8XQY7
CBG17392 6238.CBG17392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]