SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17668 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17668
Domain Number 1 Region: 66-377
Classification Level Classification E-value
Superfamily Kelch motif 7.59e-47
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 590-735
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-18
Family Fibronectin type III 0.0000525
Further Details:      
 
Domain Number 3 Region: 379-432,584-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000892
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17668   Protein: CBP36316   Gene: WBGene00037233
Sequence length 771
Comment CBP36316 WBGene00037233 locus:Cbr-hcf-1 status:Predicted UniProt:A8XRK3
Sequence
MDEEQPLEMETFDQKNESLPEESLRKIVRWRPVQNVGGSMPRARHGHRAVSVKDLIIIFG
GGNEGMIDELHVFNPQKREWYVPQIRGQSPSPAAAFGATALGTKIYTFGGMIEYGKYTSE
VYELQATRWEWRRMPTKTTGSDLAPAARLGHSFVASQKTQKAYMFGGLTNELNDNKRNLP
RYMNDLYTLDLSAAPNAVIWEKPETFGEPPSVRESHTAVIYETDTVNRMIIYGGMNGVRL
GDLWYLDLDTMHWTEIKLDDPRCGISPEPRSLHTSVLIDDKMFVYGGWVPLMSSGPGNEQ
EREWKCTSSVACWDITKNQWIPLQHYCSDPETMPRGRAGHCAAAMGDRMFIWSGRDGYRK
AWSNQVCCRDMWELETKKPEQPGKIALARAGFNLLEVSWPPVQGATAYFLQTGFVDTKDG
PASEKRVPPSPRKQPSAAAVPQKEDDKNAPAAPSLISTQGTTYTAPAPPNTTANEGELPQ
DLFDDTEKNERTSASPRPSGDAQAGLSTKKPDEGAGQSDEGTEKEEETSSHENEDDDLAW
FDIGVIKDPAVNVTHYFHARQAPLEDQIRELIDKNGFKCVNDPCFTADDKVPLINGHTYR
FRVCAVNGLGKGAWSETQSFKTCTPGYPSAPSSIRITKSPDGAQLTWEPPANTHVSGKIL
EYSVYLAVKNQSANPADSQLAFMRVYCGPLAECNVHQPSLQSAYVDHTNKPAIIFRIAAK
NEKGYGPATQVRWLQDQQKMMPVRSAYPNMNPGYVYQNQAPQQKRIRYDHH
Download sequence
Identical sequences A8XRK3
6238.CBG17668 CBG17668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]