SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17724 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17724
Domain Number 1 Region: 1057-1257
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-36
Family Fibronectin type III 0.00029
Further Details:      
 
Domain Number 2 Region: 1259-1446
Classification Level Classification E-value
Superfamily Fibronectin type III 6.79e-35
Family Fibronectin type III 0.00066
Further Details:      
 
Domain Number 3 Region: 643-856
Classification Level Classification E-value
Superfamily Fibronectin type III 4.34e-32
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 4 Region: 1680-1860
Classification Level Classification E-value
Superfamily Fibronectin type III 2.08e-30
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 5 Region: 858-1045
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-29
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 6 Region: 1467-1671
Classification Level Classification E-value
Superfamily Fibronectin type III 2.82e-22
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 461-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000294
Family I set domains 0.013
Further Details:      
 
Domain Number 8 Region: 324-402
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000111
Family I set domains 0.094
Further Details:      
 
Domain Number 9 Region: 552-647
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000662
Family I set domains 0.026
Further Details:      
 
Domain Number 10 Region: 1874-1914,1955-2004
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000122
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 11 Region: 34-94,144-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000408
Family I set domains 0.059
Further Details:      
 
Weak hits

Sequence:  CBG17724
Domain Number - Region: 244-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00537
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17724   Protein: CBP18995   Gene: WBGene00037279
Sequence length 2322
Comment CBP18995 WBGene00037279 locus:Cbr-rig-4 status:Predicted UniProt:Q60ZN5
Sequence
MNYRIFLLFCTTTVLWSVVSTQLVLGKPPIFQNTGPVEQKVAVEGEIVRLKCDDAELAEQ
YEWRVGDASGDLIAASRFAQVTVSRTNDNQKYRCVARNTVGAAISPPSVVRSKYLDDFDA
SDESAQYDVLAGIGRHFVLRTPRLLSSRNLDISYSWIKDDSNQVTPDATHFVTANGDLVV
TSVKRDDFGTYKLMASSDDLKEIVSKEYIVKDNGMAPSLQNTLSIIYFSPERTIVESSMP
HDEKFDCVTSFEAKDDVRIRWFLNGQPITGSEVGIKTTMNNRRLIISNPSGFTRGEHKLE
CRADAAMGRTSDQNSAYLTFISRPVLKDLPNEIHKKVGSSLTLKCGVKKKSSMDIKWYRN
GLMMNTQRGKLTIDRIRQEDFGLYQCEAVNEAGADMSSVWVKEGDINNDTMVMGMSEDGR
SLEEEISMETPPPRKLKFFDSSKSQEQLFPFTSDIESSQRLTKTPKDLTAASGTDKITLE
CAAAGSPPPHIVWFLNGNGIQTDSVKYDFSNGDLTIHDIRKSDEGEYTCEISGTDVKASA
NVQVNGDSLIEYGPADQKSLIGTNVEFSCEVAKEYARKATVEWYLNDALLPVNGNSGLRI
SRNRKGSLIIRQVGPDNTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMP
AKVRVRWNEGFDGNEPIIKHAIEIRTMGPTGLWSDWTTAIDNIPKDDGKPCCWADIEDLR
PSSTAEFRVVASNKHGPGKPSLPSSSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKE
EQDSGDFLGYVVRYRLAGYSSLTWNEKNLTTKDARNTLVDELITWREYEIQVAAYNKRGL
GVFSESIEVTTAEGRPTQAPKNVRVKVLNSTAVSLEFTAPEQQRIPGVNLGYKVQFWKGE
PEKGELYKQVILDPDRRQLSTVVNELEKFGHYNLTVLCFTTPGDGPKSNILRVVTEEDTP
EAVDELSIAEVMYNGAVLTWNPPMKENGIVTKYTIRHWASSSPDVKTKHEVDGSTTNITI
DGLQPSTRYGVDVMASTKKGDGPVEETKFESGVPPELPGRPSMLSIGDISATTVQLHFTP
GFDGHTAIRQWIVEGKMADSSVFAHIFNVSSPKARSIIVTGLRPFTQYQLRLIAENVKGR
GAPSEPSRTFETLQTNPETPSQRLFTEPVSATSISVSWTPLLATHWNGQPKGYLIVYREV
DEDNWKEVRTPALRSSEHTVTDLRPFTTYEVNVFSENVFGRSLPTDAVKARTYESVPSGS
PRNIVVTAEGSKSAIVKWDPVAELSTNGDVIGYKLRVVPERESLMADETREIDVPGQSTL
MTKVSNLRPFTSYYVYMSAYTIVGNGPENSTPLSFETLEDVPAPPESFQCSQISEQDVRM
KWLPPGSPNGKITNYVISYWKSHEPRSMAIDAQVAGNLLMFSAMSLSPNTQYTFAIKAKN
SKGESEEAVAEVMTSSVRLPVRNAPAPVRDTTSQHLATEITIRWDESLPRKLTEDAESPV
RAVQVSYQKTNEDEWLTLEKKFEYSKRRAVIKHLSPNSMFRFRIRFIGDFLESSWSPESE
WMRTLPSAPFAQPISLKATPYERNSVQLEWVVPHKSTWNSDAIGYRIHYREYPSNETWQM
EEIAVHDPHEDREEKVLAKLSTFRHYIIRMRLFNSEGEGPFSAPVFVYVGYSIPKRNLTN
IITEPLSSSSIRVKWDAWPKEDSETVTSFKVRYVPVASVLSSVSSEEEVMIVDTNECILS
DLRKFAEYQISVSPYNRAGEGKMSQVREKTLEDKPGPVGVLRFSDVLMDSVKVSWDEPAQ
PNGMVIGYIVNYKGYRMQEEFKNEDQQRTSRNYFDSHGLAEGVTYFFSVWAETSAGKGEL
RSANVTIGPSKDGPLPPSKPQITSGQSYVTLSWNDVANSDEIVGHLLQAKRVSVAEETEN
GYVSQRPRRNEIRGAKSAAQTSASSNSNRPTHPIGEWITLRPTDGKSEKEQVSYRELQPS
SFYVFRVFTRNVRGIGRASPETEQLFVPESIPDDPFYTTWWFMALVAMAAFVLIVIIIAI
LCVTGSSAKYRREKRSRSIDSLQLADGNFASFQLKGTSAANMTRSRELPTRPGTTQSWLS
DQSREPPAYGSVLGDGRNNGGVMNMYGLATDVIPPLPNSGPPHASLEAMQKLSALVGRDI
RSQNTAYVVSSSARGSDNERNEYMPTRSDLYGTRSEYGRVEYRGHIPSSSGGSQPQGSPQ
QQQEPYDSFDEEDDVDDDTVIRGDRTMTDGADDIARHYGSTDQYRDTWRKVRDTDMVRAP
ILTNQQPSSAAGRSSTTDSTSEGPWANIPATPNLTAGFSSFV
Download sequence
Identical sequences Q60ZN5
XP_002634371.1.8413 CBG17724 6238.CBG17724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]