SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG17987 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG17987
Domain Number 1 Region: 182-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 111-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000995
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 3 Region: 31-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000576
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG17987   Protein: CBP23664   Gene: WBGene00037487
Sequence length 265
Comment CBP23664 WBGene00037487 status:Predicted UniProt:A8XSR5
Sequence
MLSLLLIASSIIDSSFGQLPGPNDYPGRIGGRCGLFQFDCDPRARTPLCIPLAAVRDCTP
DCPNMSDEWCGQGTILCDAGVGQHRCGKCVRPQDMVNLCLDRKWQHLCAYQGTYKCAKTM
NCVFAKWLMDGKDDCGDSSDEDVCARGLVSCAGSEPTTTTVLEPVTSTEKPKEKKKKIIL
KDRCELGEFRCLDGECLDVSRVLDGHEDCSDASDENYCEMHDGVCNTAARCSFQRDVGAF
GCGCPKGFVRNPTGICEIEENRMKI
Download sequence
Identical sequences A8XSR5
6238.CBG17987 XP_002642050.1.8413 CBG17987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]