SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG18271 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG18271
Domain Number 1 Region: 42-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000244
Family I set domains 0.026
Further Details:      
 
Domain Number 2 Region: 116-125,158-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000509
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG18271   Protein: CBP19177   Gene: WBGene00037721
Sequence length 255
Comment CBP19177 WBGene00037721 locus:Cbr-zig-5 status:Predicted UniProt:A8XSA9
Sequence
MPSPLNHAILSIILLGSHVSTTKVADVPSVCDGLIEPSILSIDKPLENIKANRGNSLVLR
CAFYASPQPSITWYHRGKRVETHPAAQFETLLSATNLGQSVVESALRIDCLDERTAGEYF
CEATSPCTQPVVTSSVVSINKAPKSITGTCKSLRQPLESPPLISVFTLSRIELPGGVTQL
ACRTQGYPAPKTTWYKIEEDESLSSIEGQRNYMHLPNGDLLIVGDEETISESFRCVAENP
LGSAHQDASVIYMLA
Download sequence
Identical sequences A8XSA9
CBG18271 XP_002642282.1.8413 6238.CBG18271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]