SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG18819 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG18819
Domain Number 1 Region: 160-309,352-391
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000019
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 2 Region: 495-664
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000377
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 3 Region: 98-149
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000314
Family Elafin-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG18819   Protein: CBP32055   Gene: WBGene00038161
Sequence length 711
Comment CBP32055 WBGene00038161 locus:Cbr-kal-1 status:Predicted UniProt:A8XU66
Sequence
MKKLTLIPILALIGLVTPDELISTRCQAQCLHLMDQRLQTNIELRKTLKHHIIQLCKDDA
TCSACSAPCREQFDDIKACKKSCVASDDRETCEDSCHYLQTIYQEKPGACPAVSNSSNYE
CSALCQMDGDCPETQKCCSSGCSRQCLKPRSSDIKLLPIPRNISVQERKRKRSIIIRWAT
GRLSKAQQNENANLFLVQWRWGLHEEESAMTEWQTVTVRNKPYAILKHLLSPGRFYEFRI
AAVSQEGSLGFSAPSKPFKISKEAKAPPPPKDISLGGVKLNEAGLWNQIVQWNPPPSDLP
IKNYQVISWASSTKSEADAFEEQMRKKTTLEFAAHEKRSLASDDDDEFLGSDRDRNSVIV
PSHSTSSEIQGLFPNSVYIVEIHASVDSSDGELHGEKGVVFIRTADASGNSGVSGKGAEP
EYNGPVARIAHGIAEASEELKIEPRKSQTTRGSRPTASSPAHLEIQRPFFDNELQTQLSW
THGSYCTQNSNSNSRQTFSIKVRKTLCREYQPNHHSDTRWHDLRVTECTAILKGLSFDCD
YKVEVQDTVTGDTVVDGVFSTDTCEQTSSLTPIECSSLTTPIQCQVTSESSAHCHWTRHH
DPMQTVIGYRILLSSPVNQDTNTTINQPQLREVRYENLQPGYVYTVEVQSITNKGLGRTV
STQFVTHSDFETNAISRFPGGEIIELPLESSSGTFLRIMPLILMPLLLRLL
Download sequence
Identical sequences A8XU66
6238.CBG18819 CBG18819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]