SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG19478 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG19478
Domain Number 1 Region: 323-578
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-46
Family YWTD domain 0.0000109
Further Details:      
 
Domain Number 2 Region: 272-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000018
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 3 Region: 657-699
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 621-658
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000105
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  CBG19478
Domain Number - Region: 587-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00464
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG19478   Protein: CBP11219   Gene: WBGene00038687
Sequence length 729
Comment CBP11219 WBGene00038687 status:Predicted UniProt:A8XVN1
Sequence
MKLLLKLLLVPMLLDIKIHALPSSGGYFRNEDPHLVNSTLPSHLPTTSAPPPTSSIPILK
PDTSSPCDLIEEAAALHCIGPLVDYAADLSNNVLHPPLSAVEMTCDKYNQYMMCTQGVRP
DCRQSRAPNIEFMYETICEEKFAAIMKEEKACLLEVENDKNVKECFVNKTNTLRDETPDT
VPTPTQNYECTVIQAYVDCLIEREEATCRDAVKIEISFLSMLAKRNSEARCELNTDATKA
RPKAQPLEECDTQGNCKCRLPGYYYEAARKKCLDVDECESLSSGCSQKCVNLPGTFECTC
DQRFYKLAADNRSCERIDQSPMWLFFAHGQSVWNISTDGKSFQLQRAGLQKTAMIDIDVK
ENRLYYADIGANVIERMNIEGTFPQAVQRFDVDGLEGIAVDWIGRNLYSLRREDVLVQSL
DGRFRQSVYKNVMKLPRSIALLPAKGIMFVTDWSANAFIAAASMDGSHFRKIVTERITWP
NAVAVDVFAEKIYWADAFLDTIESANMDGTGRRIIIADAGSVPHVFGLAIADDFLYWTDW
TYRGILRANKHNGENITVLAQTALLPYSLKVFHKTLQPEETSTCATRGCDQLCLLGENGA
ATCACGEGFDLQTDGKKCRSNCTESQIECGGADPKCISKIYLCDGLAQCSNQADELKCPP
RICLPGQFQCHDNRKCLPPGGLCDDVADCADSSDELYCPHKTTPRGEFVLNSPTSSRKER
SADYQDNHL
Download sequence
Identical sequences A8XVN1
XP_002646496.1.8413 CBG19478 6238.CBG19478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]