SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG19915 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG19915
Domain Number 1 Region: 25-96
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000253
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG19915   Protein: CBP11404   Gene: WBGene00039046
Sequence length 296
Comment CBP11404 WBGene00039046 status:Predicted UniProt:A8XWQ6
Sequence
MPAKSCTISFICSFLNELIIFDKGLVMNIPRCSICLINYDTREKRPRVLTCGHSFCKPCI
LEASTVIRRESSGLIRSINCSECRALSEFSESKIPINYELSTLIGELNLDVPLVSCTECE
DWTRTTSICICTTCTSIAHNNTAADIRNKRIDIRSILKCSACILRHHASDGHSFFWAHTL
ILAVDQELTELTLRNHPEIASSAQKMSSHHCKSLHGILCNVKHKKFAKEIERLMPKFKRA
NHGKYQFNGPEDIILEEVRQLGANLRATGNLVLDFLIVTKTRMKFNTTHNSTNSYL
Download sequence
Identical sequences A8XWQ6
6238.CBG19915 XP_002633867.1.8413 CBG19915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]