SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG20297 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG20297
Domain Number - Region: 15-39
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000436
Family I set domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG20297   Protein: CBP04758   Gene: WBGene00039317
Sequence length 68
Comment CBP04758 WBGene00039317 status:Predicted UniProt:A8XXH7
Sequence
YILKVKRDAGVVIETMRIRKATMEDDGNYACEHSHQKASQIVHINKAEAQIANYSSHSAS
LLLSIFLF
Download sequence
Identical sequences A8XXH7
CBG20297 6238.CBG20297 XP_002647107.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]