SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG20558 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG20558
Domain Number - Region: 30-149
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000345
Family Galacturonase 0.071
Further Details:      
 
Domain Number - Region: 123-213
Classification Level Classification E-value
Superfamily Phage fibre proteins 0.00526
Family Lactophage receptor-binding protein domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG20558   Protein: CBP11551   Gene: WBGene00039517
Sequence length 244
Comment CBP11551 WBGene00039517 status:Predicted UniProt:A8XY29
Sequence
MTHLPYFALLAQLGKGVTGDLENLRISESQNLRISDSQNLRISEFQNLRISESQNLRISE
SQNLRISKSQNLKISESQNLRISESQNLRISESQISESQNLRISESQNLRISESQNLRIS
ESQISESQNLRISESQNLRISESQNLRISESQNLRISEFQNLRISESQNLRISESQNLRT
SKSQNLRILESQNLKISESQNLRISESRNLRSQNPRISESQNLRISKSQNLRISVFSIIQ
NFVL
Download sequence
Identical sequences A8XY29
CBG20558 XP_002635573.1.8413 6238.CBG20558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]