SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG20604 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG20604
Domain Number 1 Region: 14-378
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.73e-64
Family beta-Lactamase/D-ala carboxypeptidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG20604   Protein: CBP31849   Gene: WBGene00039555
Sequence length 450
Comment CBP31849 WBGene00039555 locus:Cbr-lact-5 status:Predicted UniProt:A8XY67
Sequence
MKQKRLIPIHGTTDNIFSEVRDSFRRNFTEGWEKAGAAFCVIHKGKVIVDLWGGYADREC
YKEWKEDTISTIFSCTKSVTAICFAILVDRGELDYSDKVTKYWPEFGQNGKQDITVEMVL
SHTAGLPYFPGVKFTEEELIDNNKMSYIIENLKTVYAPGSRTAYHALTFGWLTDQIFRRV
DSAHRTVGQFFKEEIATKHYIDIHIGECSNEENRLARLFKCSPALVSREVAYDRSILKLA
RYFYNPRGYFAAARRNLSLYGTDFTMFNNSDLRAVGQPAVNGIGSARAMAQLHQLVLDGT
LLSKETFEKIKHPRNMTAFDHMIGEPQNKEHGFTYFKSPLQTWQFGHPGVGGQMIRADPD
NDLIVAYLTNGMKTAGCEDHVFTFNRLQRKVYECLKRIPKFEFRSLRLSCIQILFSEGRK
FQFLKIPNFGTFGISQIEIFKSAKDLLKTL
Download sequence
Identical sequences A8XY67
CBG20604 6238.CBG20604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]