SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG20606 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG20606
Domain Number 1 Region: 457-543
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-17
Family I set domains 0.0046
Further Details:      
 
Domain Number 2 Region: 539-641
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 856-992
Classification Level Classification E-value
Superfamily Fibronectin type III 1.87e-16
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 646-733
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000152
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 1071-1265
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000447
Family Fibronectin type III 0.0064
Further Details:      
 
Domain Number 6 Region: 214-283
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000337
Family I set domains 0.028
Further Details:      
 
Domain Number 7 Region: 215-238,370-420
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000149
Family I set domains 0.04
Further Details:      
 
Domain Number 8 Region: 74-173
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000623
Family C-type lectin domain 0.028
Further Details:      
 
Weak hits

Sequence:  CBG20606
Domain Number - Region: 702-775
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0543
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG20606   Protein: CBP28301   Gene: WBGene00039556
Sequence length 1297
Comment CBP28301 WBGene00039556 locus:Cbr-rig-6 status:Predicted UniProt:A8XY68
Sequence
MMMMMAMMSAAVTLHKGTPFDFEVMEIVGYIKNRREDAPESTTIMKYFIRFLLTILVITR
NLAALIDVWAQDESSCPIGWQIASDQCVRIVISPASLKHAKKICHHEGGELMDTSVILLL
EDVMDLLKNLYENGLYEPTFHVGGMGQALNRTDDGNYKIITINPSSHFPFICSLSKMARR
SLLFQQKLLPIGAPKISLTGQSEIYFHPRQDADYIALPCTVQGNPKPTVSWYKNDVEVLS
PSMSNVSYLLSGGNLLVPASSSLAYSSFHCTAKNSLGEVRSPPILLKPSFIDAFRPHRLD
VYSLATGGAKLDCDAPAHQPSECFKLVPSNSLQFAQFLSQTLKKRRKTIFNTAVSLVTLF
PSRKFMSSLESLTYSWLYGSSTDRILSQNEKKFISLDGTLFFSYITSDDEDSYACSLSVY
STQSGHYGPFFRLISSTPKLANSTFPPKLDSSQPQIFPEDPKVGDSIYLECFAYANPIPQ
YKWSRVDGKPLPSRSHISNYGRVLKIDRVNYGDSGKYKCVATNAFGAAAGEVHVKLRAPP
SILQGLHDRLVPTESNVSFECLLSNADSYFSVEWFKDAKPIVPLLLPAEKRKRLHIDHNA
LHLKLADESDSGVYQCVVSNNVGSSSSSALLTVKDSAPVFPPNAMPRKVFAALGSTVSIP
CIFEASPRFHGKWADAGGSRLPQKGRIRDEDGVISIEKVLHEDAGLFFCTAHNKLGKTHA
QVQLIVMNKPSIKTNYLDEETVNMSCEVELTCENSAECPEALFEWKINDRPAKEYPSLKS
KVHEKKSGHKGRHVKQKVDLEVPKSLAGKRQIGRFACSSLYGGSSELVTKPQLPSPIALT
VEKMEEEGGGKQKKKFRLKWRLPPQHRDTRDHSPKVEGYLVELRTRKNRKWRAAERQFIG
NMEKDSITVENLLPNTEYQFRVRSVESAAIGEPSMPSDWVKTAPGAPSETIDNLKWRSLD
SQTLLVEWQPIEQGQESSGDNLRYRVSWSEASVGRNATDEMKSLNHDDDFENHLDSDHSQ
AILKLNTTEGCRMVVLAVRPVNDQGNGTVSTDTVAFLNSRGELKKVSLHNVKPINASHVN
ISWIWDTTSDCDTKHAVQITCLDVRGSEISATIASDRTFWMLGGLEAETAYDCDLKAIDN
HGNFGPTSKKFRIHTKQHPPEQMPLIGKLMMKQMKDSYTTILEWTAIELQKPNRTENGCG
YKIFIYISETATEAIELDMPVQRLSDRRNPSARLDGLKLMYMYTIKVAGYNPGGIGPISD
PRSIRLGAPGSMDYTSESSALSVTILVLVTLLLNLFI
Download sequence
Identical sequences A8XY68
6238.CBG20606 CBG20606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]