SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG21718 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG21718
Domain Number 1 Region: 142-239,330-428
Classification Level Classification E-value
Superfamily Fibronectin type III 4.68e-20
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 553-703
Classification Level Classification E-value
Superfamily Fibronectin type III 4.56e-19
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 3 Region: 1224-1343,1379-1422
Classification Level Classification E-value
Superfamily Fibronectin type III 1.94e-17
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 4 Region: 255-342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000433
Family I set domains 0.086
Further Details:      
 
Domain Number 5 Region: 983-1099
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000777
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 6 Region: 739-874
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000671
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 7 Region: 916-1003
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000231
Family I set domains 0.014
Further Details:      
 
Weak hits

Sequence:  CBG21718
Domain Number - Region: 1392-1514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00148
Family Fibronectin type III 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG21718   Protein: CBP28080   Gene: WBGene00040420
Sequence length 1544
Comment CBP28080 WBGene00040420 status:Predicted
Sequence
MISLSIVLLLFGVRCFDSTGESDKKKRTEKCQVNDDSPITISSTIDSLLNINVTVEKKPF
FTGYVTGYKLYYTKDTSQTNDEYSKWNQQEVLSRDNLYHFWIDARRNSIVKGMTFRARAT
IFFNNVESIPTGVLTVQTKLAAPKAPLIVNTKILHNSSVLISFVSADDVEPVENYTLMYK
KTEEDEWKASNFQSDVDGKVLLDGLTPNQTYEIKMFVTGDAVQGIPSNSASFTTNTTALA
LVKTEPEEEYSADPQTNEPLSIMCTVKSVSKATVLWKVNGIKVSVDSSFYTVVTSVHEDF
IESTIRAKSRTRSAKFTCIASNDAGDSAKDVNVIIKGPGSPPSEITLVAEIRGYTISWKP
PSHPNGKITKYVVYHTLNRDDPLSDWKKIDLDGSEKYVQIYMDTEESFYGRVQAATELGP
GIISDIVAMERDTQPISVESDIGGVSATTMVVNPREQVKNFSLKCYFFYFKSQSTVPPVA
SPAHRYQLQPVIEKMRVMWKWMSGIVFKPRHLLASFPQCTISQCSLRNTFIVGRRIRLEA
IILQLSLKLIPGDAPTQIQVLSVNALDATVVWHAPQFPNSPITSYIILASNDPKEDKSTW
LQYESNAKETQINRMLLPTGSLEKSTEYFVCVRAKNTAGIGPTSSLTSFVTLNGGPDGKP
ENMKVMINEANQVIVHWNTPNSTTEVTVGFGDFFKGYLIYYTRDLSLSNDDYKNWQFVEM
NNNATRISRNREFIKLVLRYKFDLSVGLKPKTFYRARIAGKNLHADGPPSEVVEFETAYS
EVPIPTDLKTDVLDDNTIHIRFSAVRDPDDHSKAIDEYRIDLAATDNVLHAEWKHIEPDA
IRIDEITSMSHQVDVEINGDSVEKNRMYWVKVTAKLDNPAWGLHSSKPRWFKTGHGKLMT
SVVLDGPPLIEKEPNLSENISVTCTGMGSPAPIITWEWMNESIENGTEGWDIHNSQLDET
TLVSKIIRNGIRESGELTCLAYNNEGNSTASVRIRVLGPGNPPENIKLTAYRNQINVTWQ
ESTLPNGDIMVTRLLLCWYLKKYIVYYSENENDDLSDWNKFETAELETYVEAFGPSVNHF
IRVQAVSDRGPGIISTTFSCLSDVLYEPLKIEILASNILEFEAEPNQNVEIRCKGTGKPK
PELFYQFGNDPEHQFEEVEADNSEYFEAKAPEINSRRNVTVVCRASNKYENVTISKSARS
FESMKITKITFSGPGEAPNNISWSFEEEDDSTLYINWNPIENPNGEKLEYNLYLSNYKTK
VSGPPVRIPDIPLNVNISLRISAENEYGEGEKTFPIWIPTPNGGPKTAPILSSLHAQDSK
VYITWAEPRLPNGHILNYTIYIKKEEDVDEEADGGEEKEWKVRDEKIFRKIFLEFQKFVY
RSNTSRVEIGIDDGLEENERYQMKMTATNERHEGPETQVYTFDLISFDENDVIDNFTAIV
INSTVFVEVENPIYTKYNIYIRDEGNNQTVKHEIDVETGKTKFEFPFHLDHTLSYTIKMS
GMKLGRESPPSEEIDLEFQSLNLAKPTQMIMATSRRKVIKEPPL
Download sequence
Identical sequences B0K0B3
6238.CBG21718 CBG21718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]