SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22374 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22374
Domain Number 1 Region: 40-416
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.32e-66
Family beta-Lactamase/D-ala carboxypeptidase 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22374   Protein: CBP05350   Gene: WBGene00040947
Sequence length 418
Comment CBP05350 WBGene00040947 locus:Cbr-lact-9 status:Predicted UniProt:A8Y237
Sequence
MRWYSNARVLLGASVLAVPLAAATDKFSEKFKKSENLEQKIQKAREMVETTMAIQGIPGL
SIAVTVDGKMVWKSGFGYANLESLARCTADSVMRIASISKPITATLAAQLVENGKLDLDA
DIRKYLSEFPAKKFAGEDVTLTMRQLLSHSAGIRHYANPKKKSATLEDPSNNNTEVPEFL
SNKPYATSLEALEIFKNDDLVAKPGSKFAYTTFGLTLAGAVLEKCSGKSYGQLATALFSD
LGMRHTQLDTKKKIVTGRVGYYQRNSKNILENCPEVDCSNKYAGGGIISNVTDLLIFANA
ILNIYRSEYRKTIVGEETIRKFISEQVPVDGKNTSAGLGWFLVDGTEIKSIEGNVANSPF
FYHTGAAVGASSVLLIKPSSPSTSSESSGVCVAILCNLQNVSVLSLGRDIGDLFHNSM
Download sequence
Identical sequences A8Y237
CBG22374 XP_002647198.1.8413 6238.CBG22374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]