SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG22758 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG22758
Domain Number 1 Region: 225-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000311
Family I set domains 0.058
Further Details:      
 
Domain Number 2 Region: 111-209
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000588
Family I set domains 0.0067
Further Details:      
 
Domain Number 3 Region: 20-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000141
Family I set domains 0.036
Further Details:      
 
Weak hits

Sequence:  CBG22758
Domain Number - Region: 304-404
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000306
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number - Region: 425-551
Classification Level Classification E-value
Superfamily CBD9-like 0.000471
Family Cytochrome domain of cellobiose dehydrogenase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG22758   Protein: CBP33626   Gene: WBGene00041247
Sequence length 576
Comment CBP33626 WBGene00041247 locus:Cbr-wrk-1 status:Predicted UniProt:A8Y339
Sequence
MMKLVLIGLGLLIASSTAQIRTKGGTLIAKEGESLTLRCEVEDPSIAIIWRKNNDVVAVD
DEILDTYGGYEIAMEGSTSVFTIKRVEPINSANYSCALAEPEVSVTFVIKVQVKPLVLIS
PDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTKQAAKLPEDIKKDHEGARLVFPEVKKH
HAGKYNCLAENVAGMDRATVEIHVAEPLQGEREEKPWVKNEDTFIPVRKNQNASFWCTYD
GTPVPQVEWLFNGYKINFNDEKFKKTSETAQRLNGYSKSTLTVGDITEEAFGDYACRISN
KLGSVIAVVHVSGRPGPPQLSLDDSELSWTVRAFDKILEYQLCHRLENADHFLPENCNSV
RVKKSDNNGDDKWTHTIDLQSYLEQGQKYHVQLKARNALGWGSMAKDAINVELRRPEKAN
VESTPCTFVTNGQQITYGVRGNTIHFRVVLTGIAPNGSGWTAIGFGNSMFSGLDVIVVRV
LNGRIIVTDEFVRGFQSPVPDRQNNVQVYGLRYENGVVVASFSRSVFSTEQTDANLSGCS
PWKFTVGLNRMSPQGHLFHHSQTPVHRVVCINQCTV
Download sequence
Identical sequences A8Y339
6238.CBG22758 CBG22758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]