SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23085 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23085
Domain Number 1 Region: 332-634
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.86e-47
Family beta-Lactamase/D-ala carboxypeptidase 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23085   Protein: CBP29898   Gene: WBGene00041505
Sequence length 659
Comment CBP29898 WBGene00041505 locus:Cbr-lact-8 status:Predicted UniProt:A8Y4R2
Sequence
MRKIVSIGMFRWMQKKHPSVCGTIISRPAQCFLRRHLVIPTLTNAMVKMLFISPLLFFLL
FFLIPAADSTVQPNVTLLTLGDLWETRGMIRTHLFPTKTSTVYPEFAAIPSNQGDGRMHL
TRSALNKAIENVAEMNGVLIHSICSYRHLNVTFYTLNTMFGIGRSEVLIDANMTEMEHKM
SEMTDRRIKVNFICVGANNDTYSAVWHHSPDFVWHFIVDSGPIREIIEKDRLQMTRGYYA
DCFQTYRNDNISRAIIIWRKGFGKKYRIQYGTEVHEMLTDMQRTDLEPVQFASLPRLGQK
RPFPRWILWHGDEFTWGNRTIPRDLSKMNHNWEALNSVIEHRMRSYDIPSISIHILRDNK
MEYSASYGFADILQSIPVKTTHRYRIASVSKLITAMTIGELLADYKHIDLLTPVFGPAGV
LSDVCSPCHPFLLHVRIIHLLEHSSGAWPHTSKFEFDRMEQNQTEFLMRVVQKEFPILFP
GGRHMYSNIGYILLGRIIEKVSGRSYEEYALEKVLNPLGVNATIGKEGDPFEEVTYYSHD
NANAYTSWSTRRLNSAAGWAMKAEDVTKVFHHLEEHKLRRFRWIITPSAVRWNYGRGVQL
GNDGSLYHIGSLAGTEAIGYTWQNVQVAILTNIRGKEQNEQTGWMEKLCKSIADGRFTR
Download sequence
Identical sequences A8Y4R2
6238.CBG23085 CBG23085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]