SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23341 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23341
Domain Number 1 Region: 34-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23341   Protein: CBP05516   Gene: WBGene00041712
Sequence length 183
Comment CBP05516 WBGene00041712 status:Predicted UniProt:A8Y455
Sequence
MLRQIVLMCAIQTAYSFSIRDIINGKRGADAATPCPTWHPFACPSGECVPIKYLCDGSPD
CSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLVKVFGPKAKAELSGMGGVDKV
AVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDELTSNEAADFRFFVQKLQET
GFF
Download sequence
Identical sequences A0A2G5TGQ2 A8Y455 E3LPV9
31234.CRE27344 6238.CBG23341 XP_002636634.1.8413 XP_003114144.1.11157 CRE27344 CBG23341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]