SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23422 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23422
Domain Number 1 Region: 203-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 278-325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 333-364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0034
Further Details:      
 
Weak hits

Sequence:  CBG23422
Domain Number - Region: 242-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000103
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number - Region: 140-192
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000575
Family Tachycitin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23422   Protein: CBP34518   Gene: WBGene00041783
Sequence length 365
Comment CBP34518 WBGene00041783 locus:Cbr-lrx-1 status:Predicted UniProt:A8Y3Y5
Sequence
MAWLVETVLFLFAIRQALPQDVYGAPQQPYPYVQPSASSGSGSYIPNPQSSIHTVQQPYP
NVDVVEPDVDSVDIYETEEPQFKVVNPFFPSSGGSVEPGTLPPPVAPPQVPDKPDNSYAI
NYCDKKEFPDEVLKQYGLERIDYFVYNTSCSHIFFQCSIGQTFLLSCTSQDQAFDKSTEN
CNFKNAVKFCPEYDHVMHCTIKDTCTENEFACCAMPQTCIHVSKRCDGHPDCADGEDENN
CPSCARDEFACVKSEHCIPANKRCDGVADDCEDGSNLDEIGCSKNTTCIGKFVCGTSRGG
VSCVDLEMHCDGKKDCLNGEDEMNCKQEGKQKYLLCENQKQSVTRLQWCNGETDCADGSD
EKYCY
Download sequence
Identical sequences A8Y3Y5
CBG23422 6238.CBG23422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]