SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG23724 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG23724
Domain Number 1 Region: 172-478
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.49e-112
Family Glutaminase 0.00000527
Further Details:      
 
Domain Number 2 Region: 493-589
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.22e-17
Family Ankyrin repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG23724   Protein: CBP37114   Gene: WBGene00041999
Sequence length 600
Comment CBP37114 WBGene00041999 locus:Cbr-glna-3 status:Predicted UniProt:A8WJ54
Sequence
MEKNEEEQLEGENIQEDVGRVMEDEITNNQDQKVESSSSEEKPKTPTVHFTKPSFYRVNT
VISDVKVCRSMSYDMCGNHQQELLFDLYKDETTGKVYLPRFFKALLESGIRKDDPRIDKM
IQNIKDADLLDDFVWGSQHIYLEKDTFKKYIGSSIGVVTKALKKQMIIPDWERFVGDMGE
IFEDVRGFNEGELATYIPQLSRVPPDSWAMSVCTIDGQRKSWGDSLNPFCLQSVSKPFTY
ALVHDDIGPEALHAHVGQEPSGRLFNDISLDHNKKPHNPLINAGAIVVASLLKNKTPLAD
RFDFMIHACRKFVGSGYIGFNNSVFLSERETADRNYALSYYMREHNVFPKDLNLQDTLDL
YFQICSIETNCDSLAVMAATLANGGVNPMNGERVVNNRACRDTLSLMYSCGMYDWSGQFA
FHVGLPAKSGVSGDMIIVIPNVMGIALYSPRLDKLGNTVRGVKFAEQLVQKYNFHNYDSL
IYSDNKKIDPRRQLKDDHDGQNRFMYATKLGDIAAIKRFLLMGHDIHCKDYDNRTVLHVA
AAEGDVVTLEYVLSKWQEDPDPLDRYDRTPLDDAKHFNHTACIKLLEEAITVFNLKQQDD
Download sequence
Identical sequences A8WJ54
6238.CBG23724 CBG23724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]