SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG24391 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG24391
Domain Number 1 Region: 30-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000112
Family Nuclear receptor 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG24391   Protein: CBP12876   Gene: WBGene00042515
Sequence length 130
Comment CBP12876 WBGene00042515 status:Predicted UniProt:A8WKL7
Sequence
MTILNYYYFVMSSDKPSTSSTVTQKDTTVTPCTVCGDVANGKRYGTWACLGCIVFFRRTV
LRKMKYKCQRDGRCEIAVNELDIRWSEYAYTAFFRDYRMDKLIKYAEMLHRGKYWKKNLE
MLRMILLRMI
Download sequence
Identical sequences A8WKL7
XP_002648259.1.8413 CBG24391 6238.CBG24391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]