SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG24788 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG24788
Domain Number 1 Region: 680-969
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-57
Family Protein kinases, catalytic subunit 0.00000787
Further Details:      
 
Domain Number 2 Region: 183-358
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000536
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 3 Region: 384-588
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000192
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG24788   Protein: CBP35001   Gene: WBGene00042825
Sequence length 1168
Comment CBP35001 WBGene00042825 status:Predicted UniProt:A8WLH7
Sequence
MGRKAVLATQRDDVVDGTKKICRWNKKKGLGEGGGILEVYKYWSWLIFSGIQGFKDSGMQ
GFRDSGIQKSRESRIQGFSYRGIPEFRDSGIQGSRDLRIQGFQDTGIQGSKDSRIQGFKD
SGMDTVTPITIANPPLKQILAVSQSSQPYPERSCFELPSSKGIVFSIVNEGKTGALLEVT
KSSSSSACLDVSMPQTQYEIYFTRKNTDKVKHVRSFSDRIHGENGILDKETDYDVAVTWL
NRYSPASGVSSSRSFRTGFGYPSAPRDPHAIPVTPDTVYLYWSLPETLNAPISEIKYKIS
QQAAGISVPTSIAVIPLSETVSSNISSDTTACLINPCRVKIANLRPSNEYKFWVTATHIS
HLDAATILKDDDAVSSEAVARTLDVPGTLRPDNVTGSSLLLRWNGLEPEHRPTSIAIQYR
ESGGANNEWQSPTNASFEPDVATELVPVTNLLSATTYDYRFVATYTGTYTIDGKVLAFKE
DYLQLIQQARTKAGVPTAPQSVEAKIDTEGWIVTWKEPMSDGGSPITSYAVETRINKTAE
WEIAERGLDGWKTWWRPGKSETSSSMSYSSEVSEFRIRAANIEGFGAYAYTEEKKEEKEE
EKGGILPYFLGISIILLLAAMILVGCFWCKLGTSGLQRNSNSFSVKSRRRQQMKKREAED
ERNCIRLDVVANMNFTNSRQTLSPEYESEIRNLPIVDYNDVEIVRHISDCSYGSVHEGIA
EEVPLSWEKQVKVAVKQLRPKSANHDFDRMMFMKEAILLNNLDHPNIVKELGVCVSPGQG
LILLEYMEGGNLLNFLRESAPSEMQASELSTRDLLAISVDIARGMNYLERLPHVHKNLSA
RKCLLSGRPGVAKLEMGMPRALSKGEINRVDLESMQSVKWMAPEVFKDLMFTSKSDVWAY
GVLLYEIFSFGEEPYGSMDSRRVITDVRDGNLTLPVPPYCPSKKICKVMKMCLISDPNKR
ASFATILKIFETCRDDQQSQDDKRIHFNEGSDNINFNASQDSTSSREPPSPSHRIREFTQ
ISGDLEPPSPSPLNQSFGGFEHPYGNVINTLIEWHPSSTVVSATSSMHSPSSSNRTNHYE
LPMSRLSAAPPIGIVNNAFESSNNSLNMSRSWTGLAGEVNPNPAGASSSGTLPHHANSMV
HLRAPTGQPPTRVNRNSSGGTCRSVSQV
Download sequence
Identical sequences CBG24788 6238.CBG24788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]