SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG25156 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG25156
Domain Number 1 Region: 32-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 2 Region: 76-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 122-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG25156   Protein: CBP37384   Gene: WBGene00086570
Sequence length 158
Comment CBP37384 WBGene00086570 status:Predicted
Sequence
MILRFLIFTALAVTTANSSTRQQAAAASSAFHSIQVCNENDFRCSDGKCIRAEWKCDGSG
DCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRCDNITDCADGSDEKDCPASTV
DCSSPNVFMCADGRQCFDITKKCDGKYDCRDLSDEKMI
Download sequence
Identical sequences 6238.CBG25156 CBG25156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]