SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00233 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00233
Domain Number 1 Region: 17-47,110-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-25
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 224-309
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.93e-20
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Weak hits

Sequence:  CBG00233
Domain Number - Region: 302-340
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0445
Family Tetracyclin repressor-like, C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00233   Protein: CBP00030   Gene: WBGene00023665
Sequence length 461
Comment CBP00030 WBGene00023665 locus:Cbr-twk-18 status:Predicted UniProt:A8WMI5
Sequence
MAIVAAGVSKVLTTFQKTFKGLLPLIILVIYTLLGAWIFWMIEGENEREMLIEQQKERDD
LIRRTVYKINQLQIKRQRRLMTAEEEYNRTAKVLTTFQETLGILPADMDKDIHWTFLGSI
FYCMTVYTTIGYGNIVPGTGWGRFATIVYAFLGIPLTVLSLYCLGSLFAKGCKILWKFFL
RSTRVVSKDLSEKISEAADNIEEGTTAVAPASKEENDDDDLLSFPISGLLLITVIWVIFC
AVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMPIVGVLLLIGLSLVSTVMTLI
QQQIEALASGMKDNIDQEYARALNEAREDGEVDEHVDPEEDPETNKKSLNAVVSRMPLSK
RALYYFLPASQKKQLEQQSEKKMGRKSIKVQTDSELLETLIREEILKAELNNEMHKFNGP
RSSQQPRLIHSEIREKEVPIEVVRVEQYNHGGHDDYLEHDI
Download sequence
Identical sequences A8WMI5
XP_002645311.1.8413 6238.CBG00233 CBG00233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]