SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00618 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00618
Domain Number 1 Region: 35-416
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 9.6e-63
Family beta-Lactamase/D-ala carboxypeptidase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00618   Protein: CBP28628   Gene: WBGene00023987
Sequence length 423
Comment CBP28628 WBGene00023987 locus:Cbr-lact-4 status:Predicted UniProt:A8WNG0
Sequence
MLYKVAWFIGVALVFVAIRNTNPEREIHVDGDVAKEWSHVADVFKKNLEENWERSGAAFV
VYHKGQKVIDIWGGYSDRESQRKWTRDTLSVAFSCSKAIGAIVIAKLVDEGRMEYDDLVT
KYWPEFGKNGKANVTIRWLITHKAGLAYTDHPIEWEDAIDSKKIDRILADQKPNWPPGTE
IGYHAVTHGWLVDAIVRRVDHKKRTVGQYFREEIGQKFGLDFHLGLPLSEQHRVARIENP
NFWNVLEEIVYAPSDFDVIRFLRDRITNGTLSKTTASTPFIKFVGAMTLNNPDLHRIEQP
AVLGIGTARALAEIFELLRQNKIVSENVKRQMFFENYEMSEDFISGAKVPRGQGFMLKEF
QHRGNPVKMYGHSGYGGQNIRTDFDHEITICYFSNGLKVGFGDTARTYKRLLEVVYDTYF
KLE
Download sequence
Identical sequences A8WNG0
6238.CBG00618 CBG00618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]