SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00713 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00713
Domain Number 1 Region: 40-67,130-192
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-16
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 201-296
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000144
Family Voltage-gated potassium channels 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00713   Protein: CBP26727   Gene: WBGene00024060
Sequence length 383
Comment CBP26727 WBGene00024060 locus:Cbr-twk-3 status:Predicted UniProt:A8WN88
Sequence
MTVSLEENAKIQMLSAASKDKKSTTERSLIEKYHLGPLALHTGLVVSCVTYAVGGAYLFL
SIERPEEMKRRAKAIFKFQELKDQFLGNLSALQPETDRILETYTKKLMYMLEDAHNAHAF
EHFIIPNGVPKDMWSFSSALVFTTTTVIPVGYGYIFPVSAYGRICLVAYALLGIPLTLVT
MADTGKFAAQLVTRWFGENMAIPAAIFVCLLFAYPLVVGWILCSTSSITFLDSVYFSLTS
IFTIGFGDLTPDMNVIHMVVFLAVGVILVTITLDIVAAEMIDRVHYMGRHVGKAKQLAGK
MFQLAQSLNMKQGLVSGVGQLHALARFGMLVGKDDVEKTVPEDGVIAFSPDVMDGLDFVD
NLSIYSRRSRHSAGNSARNLFLS
Download sequence
Identical sequences A8WN88
6238.CBG00713 CBG00713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]