SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG01192 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG01192
Domain Number 1 Region: 72-229
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.62e-20
Family Nuclear receptor ligand-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG01192   Protein: CBP14009   Gene: WBGene00024460
Sequence length 588
Comment CBP14009 WBGene00024460 status:Predicted UniProt:A8WPT1
Sequence
MTFRRALKSRKFPKCCLNGENCRNCRFYQYQKFLAVEMKWLVPLPLKHLFQPLTPYLQIV
INQLKLMDNRGKHVFHSYALMDDFNLDTLVLYTSTNYIAKHEHFHFTRHGCAAISHTTGI
DFIKKFEFISLLSAKELIGFIEKAIMPYTLFCTAMRSYTNRREAAEFPGGVDVICEDLEV
CDANAPAVLDNLRHPLVAKLKELKITNEEFLLLSAVTICNSVAAKLSDESPCGDPFYSSD
IDFLAAMVVTIIKHKPRNKRKALSALKDENGGKKSKLSEYSSKQAVDDIIESVDDMSNPL
YELLSNDFKSKEEFTVNDIAMMFKSLAETILKLQSQNTMLKNQNCILNANLSNLTEKVDG
LEENLKLLSSQPKESPKPPTTLIKTFASAVASTISAPKSQISFMRAASLANSEDARKSNV
IIKNIDLSSMNYILSNIDWDLRFSTMSIDEMFDDLRGILLELIEYFVPTVTHLIHNIIYS
KETKQLLKKKLLIWKKAGNSDEYKHVSALFKRSLVKSEEERIYKRKSDIPAIRYKSNENV
IMSDEGKAEIFGDCFSEFFNIDKDILPATGNLTSKFSSDVIFTPENIE
Download sequence
Identical sequences A8WPT1
CBG01192 6238.CBG01192 XP_002635962.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]