SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03756 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03756
Domain Number 1 Region: 31-75,124-199
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-20
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Domain Number 2 Region: 188-281
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000379
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03756   Protein: CBP34217   Gene: WBGene00026549
Sequence length 470
Comment CBP34217 WBGene00026549 locus:Cbr-twk-29 status:Predicted UniProt:A8WWM8
Sequence
MKLEEDDEELKKCMEEDILKAFLEEDFNSQHYDSIWECLQHNRRAIAVNGFIIIFLIVYT
TIGGFIFLNFEFEYQQYMKQNATLEKRLCIESLLNRDNRLRLTRASDVAAAIAERCLTEK
VKDDRMQWSFKSAALYSLGILTTLGYGKIEPQTINGRISTVIYGFFGIPLTVILLTNFGR
YLEAMATRFRRLLTCRKRREDEEENVSGSTLFFIVLVYLIVGAITIPLMSGQFDFFNGIY
YAFICLTAIEYGDIVPQNNWFVPISVFYMCTGLAISTIALDIGSIYVRKLHFIGKKIKNI
ANIRIWFGARNLEVRELITAVGQNIGIDQNVIADIDIDTLVKTAIQVKLGRLSRVPQTHM
IVEGIWPPELVPLFMKDGQFPLFVDSEDDLTDIRPKKYSVHFEDEPMISEIDDTQSQMTS
SRLSPMPPRRPMQLKLRDSTTDSSDQAHRDGAMNSSEITTTLTSDLSTDT
Download sequence
Identical sequences A8WWM8
CBG03756 6238.CBG03756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]