SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04825 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG04825
Domain Number 1 Region: 148-193,262-332
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-22
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 349-464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-16
Family Voltage-gated potassium channels 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04825   Protein: CBP06838   Gene: WBGene00027429
Sequence length 564
Comment CBP06838 WBGene00027429 locus:Cbr-twk-34 status:Predicted UniProt:A8WYK2
Sequence
MVDQIVFKGNMSNRNGPGNSHFLEEIDEEDDGGVKPPNEEPSVSTESKEPMKPAPEDKKA
APEEKKKYRVHPTMQNLPLARSNSSTSLSKAEAVEKYYERNAHTVSGIHKNQDTFGQLQK
RYKPKQDAVSVLSSPGALGETVLPTPRHFDRSMYWFAFHRKQIGLRHIIVALMVLSYTIF
GAFMFWSVESRYERAITLERMTNLEELLGKISENITEIVNDPKTNTTESEMKAYIRDAYL
TLMKLEGQYKGSTYYKLEDHGRNWKWTFESAFFFSMNVYTTTGYGSIAPESTLGQLLVCI
YGFIFVPVTLVALRDLGQFFLVHLTKLYAQLIQRMRELNGDRTLDVNEIIKIPIKACLLL
LALYLAFCTIFIHFFDEFSGQESGTGMSLFLCFYFSFISLSTIGLGDIMPNNATFSPIIS
IMFFFGMALTKVVNRNTFIAVENGIFGALTLVENKLDGIVRRGKVMPEEKEKKPTKQPSA
PHPPHIQRALSVEDYVAAQRENTNDVLNNFTVRSIATFMKSNTDIYGGGFGRVQLRRGDL
MGSDHQMTTTSIDNKPPNQQDSAV
Download sequence
Identical sequences A8WYK2
6238.CBG04825 XP_002638001.1.8413 CBG04825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]