SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05661 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05661
Domain Number 1 Region: 124-167,214-277
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.35e-18
Family Voltage-gated potassium channels 0.0089
Further Details:      
 
Domain Number 2 Region: 285-383
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.23e-16
Family Voltage-gated potassium channels 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05661   Protein: CBP28341   Gene: WBGene00028066
Sequence length 543
Comment CBP28341 WBGene00028066 locus:Cbr-twk-36 status:Predicted UniProt:A8X0D7
Sequence
MERLEAEPKLRKRSTNASILTLPGSRENSFSRLAVQRSTSVDVVPKHRVTYEDQKTEEID
KINQYYQKNHYTVTGNQETFNKLPRNVSANRFKVDKASISHKSQKSMQKSLEAEPMIPEE
RHFDKSFYWFAMHRKKFGFRYIALLFLALAYTLFGATVFYLIEGNHEQSILRVREQNLDK
LLDELDFIKESYISLQKHEEQYKWSTYYRLENPDNLKWTFSSAFFFSMNVYTTTGSISAQ
TMSGQLFTMIYAFCFVPVTLVILRDLGQMFLVNFTKLYAHALTFVRNLRGKKEIDEDEMI
QLPIKYCMAILIAYLIICTTFVYLYDAIMGPEWDTGLSYFTAFYFSFISLTTIGLGDVMP
NNVPYAPPVSIIFFIGMAVTKVVNRATFIAVENGVFGIMTLAETKINHLLTKSEPITELP
KTRKCGSSGGRREKEKDSESTSSSSSSGSSFSGSSQSSEDPGFGLFEDSSSENYSEDGMI
NQRRNEMMNTFTVRSIATFMKSNHDVYGGGFGKVQLRRGDLLKHNNNAHTVVGGTTHRIR
PVV
Download sequence
Identical sequences A8X0D7
6238.CBG05661 CBG05661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]