SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05682 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05682
Domain Number 1 Region: 201-244,313-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-23
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 387-485
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000183
Family Voltage-gated potassium channels 0.0054
Further Details:      
 
Weak hits

Sequence:  CBG05682
Domain Number - Region: 494-573
Classification Level Classification E-value
Superfamily GlpP-like 0.0301
Family GlpP-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05682   Protein: CBP21631   Gene: WBGene00028085
Sequence length 619
Comment CBP21631 WBGene00028085 locus:Cbr-twk-33 status:Predicted UniProt:A8X0F6
Sequence
MDIGIDGHQINVPKTLFNSCQCACCCSNVKKIHEERDSLHDEEQNLENPDSQERKTAISG
GESPKLSPDLQKLEDPLEDSDDERPRARSVSVSNADLEERNRLDSVSELDKSQFSTHRYT
RHASIDRGNATIGTKVGNPEDPIEKYYERNNYTVTGRDRDFYNKLPSHLQHRMSTHGDGI
SRYSSPGALGQPVIPTLRRFDKSMYWFAFHRKQIGFRHICVVILVLLYTLLGAAMFWSVE
SRHEKAKTLRHVHHLEELLEKLAENMTESVNDINTTTSHSEMKVYIREAYIELMKLEGQY
KGSTYYKLEDPQNNWKWTFESAFFFSMNVYTTTGYGSIAPESTLGQFLVCLYGFIFVPVT
LVVLRDLGQFFLVHLTKLYALGIQKFRELNGDKHVDEDEIISLPIKACLLLLAAYLGACT
VFIYFYDELSGEEAGSGMSIFLCFYFSFISLSTIGLGDVMPNNATFSPIISIIFFFGMAV
TKVVNRNTFIAVENGIFGTLTLVENKLDGIVTRRSAAVKPEDKVPSPKVQRAFSMDADSV
AQPEEAANEVLNNFTVRSIATFMKSNADIYGGGFGRVQLRRGDLMNTDNQMTVNSVSQLR
HRAPSQSNNNNNTGGGHNV
Download sequence
Identical sequences A8X0F6
XP_002638629.1.8413 CBG05682 6238.CBG05682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]