SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG06143 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG06143
Domain Number 1 Region: 280-323,402-469
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.82e-22
Family Voltage-gated potassium channels 0.0043
Further Details:      
 
Domain Number 2 Region: 472-593
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-16
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG06143   Protein: CBP31625   Gene: WBGene00028462
Sequence length 715
Comment CBP31625 WBGene00028462 locus:Cbr-twk-25 status:Predicted UniProt:A8X0T6
Sequence
MPVVELCPSQFELNRMADNPHLYSGPSVSNESIQMPRSPTQPLRGTQVFLKEFKRTKLQP
EDSIIEETESCSSMSSKSSEESASDTIMVPPDPEKENVPEKILLTDPSTVLQNVKFQRKS
AEAEDAVSVKRNTKSQRSCRIRTGSESEDLKKPIKSILRQSPYISKEDVSQSNESTIHRQ
FRKSRTSSLTKRDSVNNDRTEPGNHDAIDNYYAKNYYTVTGIYQKNPSFPKYYVNGNADE
DNEENHEAVRRNYEKHGKLTLSMAQSTRSMPIVPVNNRFHKSFYWFAHNHKKIGFRHVCM
LLLVLSYTLLGAALFFSIESRHEHETMQIHKRKLERVIYEIAQTLELEILDPMKLTNITQ
MEYFITVNKQLPLLFNLRAYVKLLNAEDLYSGSTFYKHEDPKNLKWTYGSAFFFSMNVYT
TTGYGSIAPASSLGKALVILYGLIFVPLTAVVIRDLGQWALLYLTKMYTILIDNFRRVRG
FVDKLDEDEIISLPIKFSVSVMIFYLLSATMFIYEYDELSGPPDSGISFFHAFYFSFISM
STIGLGDIMPNNVTFSPLITIMFFFGMPILKVVNRVTYICLENGVFGTMTVLENRLDTIW
SSATVIPTGQSPQEQQSQPNSVSRKTSMISDGMVPDEVSFRLNLNILLNFYTQTDGSVPN
EYLNNFTIRSIATFMKANGDVYGGAFGRVNMRRGDLRNLTDNQATDNRSNRDNNV
Download sequence
Identical sequences A8X0T6
CBG06143 6238.CBG06143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]