SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG07369 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG07369
Domain Number 1 Region: 13-52,109-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.36e-23
Family Voltage-gated potassium channels 0.0051
Further Details:      
 
Domain Number 2 Region: 195-308
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-18
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG07369   Protein: CBP35639   Gene: WBGene00029434
Sequence length 424
Comment CBP35639 WBGene00029434 locus:Cbr-twk-23 status:Predicted UniProt:A8X4X5
Sequence
MGKKKESMAKCAWMKFRNVLRIALGHLALYCFVVCYVFAGAWVFHQLEGENETELHDKQR
EYAMNLKKDVIAKLATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPSQVVPKRWTF
PSSVLFSFTILTTIGYGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGRFSKTAIMALV
QKVSKRELKKQSDEHLLREIAEVMLVAGLFVVFIAIGSAVIPLWENQLTYFDSVYFSYMS
LTTIGLGDIVPRRMDFLLPTLIYITIGLWLTTALVEQLADVFRLVHYAGRQVTNVKGITV
WLGGRRLSMGGLISTVCRRVGMSENLINQINWDRTVIDALDGKMPPTLPIFPWHFTDFLE
HDPPLIDLSIDLDQMDGSFYCSKPLSAKKQRRASQMSAPAIAWMRPQEEARILDADGNFP
NIDA
Download sequence
Identical sequences A8X4X5
CBG07369 6238.CBG07369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]