SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09380 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09380
Domain Number 1 Region: 10-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-28
Family Nuclear receptor 0.00049
Further Details:      
 
Domain Number 2 Region: 427-560
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-23
Family Nuclear receptor ligand-binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 197-267
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000673
Family Nuclear receptor ligand-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09380   Protein: CBP34401   Gene: WBGene00030976
Sequence length 585
Comment CBP34401 WBGene00030976 locus:Cbr-nhr-47 status:Predicted UniProt:A8X982
Sequence
MSEKLPPGTLCAVCDDVATGKHYSVASCNGCKTFFRRAIVNRREFVCQGNKDCDVNKGVR
CACRACRLQKCLAVGMDTNSIQRDRDRIGYTKRKRKHDDDDKEETHHFENLHMRDGSSGS
PQMNDDSPENCDMKDIKIDFNCLDPIAERLTTLENNFTLLLSRCADLHSYATLEDALNAP
SRFMQPISCEWSDSVVLTHRDDKMPFWRQRLIALYIDWAKTFSTFRSLPYTDKVAMVTNH
ASSFMIMCEAFRTPEHVKSDVVRKRPDLPGLVHNNSGGCTRVQSAETNGEESHDDLTNML
LSQCIQQSINNGIMFDKSAEEKVKMPVPIRQGNEFIQIKQEIMDVPTTDGMIQLPTEYGI
LPADYGTWIPQDYGHPTAGHEGKSDMHNFFEAREFCPPGRPSSCNLNERAMKTISMVEPR
LFPSISSSSSSLSGITPVLTMMIDLVMKPFRQLNFSTTEFALLQAIMFFDPDTEGLDSAS
QRNVIAEQKKLLAVLFRHLQKAYTFDAANERYASIILRMPSIRRAAAKKNESLQVLDMLQ
LHEMNSLVKETSLGPRPSTVQQRMGIGGGAGGCLTFSSETAGEDV
Download sequence
Identical sequences A8X982
CBG09380 6238.CBG09380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]