SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09670 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09670
Domain Number 1 Region: 209-308
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-23
Family Voltage-gated potassium channels 0.0036
Further Details:      
 
Domain Number 2 Region: 4-44,108-178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-21
Family Voltage-gated potassium channels 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09670   Protein: CBP25527   Gene: WBGene00031224
Sequence length 687
Comment CBP25527 WBGene00031224 locus:Cbr-twk-12 status:Predicted UniProt:A8X8I4
Sequence
MTLFQKLQWFCQLIRLRAYYKFLLLIAYTLFGAWLFRFYELQADIKRRAIYGNDTNLIRR
QLAERWIEMHDDAVLRNNSVLRRRRAAEAVDWLLGELNLSDHMREFSEDTPWTWTGAMFY
AGQLYTTIGYGYPTAKTDEGRICTVLYALFGIPCFLMYLKAIGKTLSKRLKKIYKRVRRS
AFGKFLLPTRVTATKDGFEDPDASAEERKRKPFPIPIAIILLIIWICFSASMFCQWEKTW
DFPSAVYFFIVSISTVGLGDMLFRTPDMMVFNFLLILFGLALLSMCFELITDRIAKWKQK
RFDEHIKKVQKMAFQVFEKDPFVEEAPPLGIRMAPNLMQIAATHVSEEKRGFFAELKDWF
AGKVTDNVIQSKLEDTDDESDEDEALEEFESPQVATLTANDLVVCTNGGATRRVSKQSYA
FSDVSNLSNSKIPPGNNYGQLLDRIKAMEKFKPKKGDLDSRMFAKFLENKKLAKILEQTE
LRELATVSCQTDLSGLVVQRRNPKGRHARIGSCSSQSTMSTFLPRNNSHAPDEDSVMSIT
FGDLKFDYITEPLIDEYHLRESNHSIFDFDDDEVVRIPQKMLVSRPGMPPPPPSRPSQLA
SPLRALLEKEQKYDEDPEIQLTPRRLASLTDVQARKVKLGYDENLQHARLVCGLLPQDFD
SPSTSTSTSMIDSGYDLSKRDAPVNIV
Download sequence
Identical sequences A8X8I4
CBG09670 6238.CBG09670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]