SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13286 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13286
Domain Number 1 Region: 156-181,238-311
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 350-449
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-22
Family Voltage-gated potassium channels 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13286   Protein: CBP25626   Gene: WBGene00034066
Sequence length 1201
Comment CBP25626 WBGene00034066 locus:Cbr-twk-31 status:Predicted UniProt:A8XHH2
Sequence
MFFTSSMRHASPTTTVLADGYTDDALGSKYDNFRVMIRDLSMGFVRDLLLDSISAVFTGI
ASIEYIAWIKNSISQFSFQSRDDGTTINDDDDYRKEQKNSLKVRYRGRVVRMFAGQFSRT
GSLEIEGGSEVQLSPPPTSFLGRCKYYYDKYKLHRISASVLLILYSFLGAWVFYYFEHDY
EKEVKQKERTDLRMLRNDTFQRITSMVFRQGSTPNFEETFRDVFIEYEKRLHKVRLPECL
DWDYWGALFYVGTLFTTIGYGNIAPRTALGRAASVIYAIVGIPLVLAILSKCGKWMTTSL
SVSWQQHRLRIKEKAKKTTNRLRGKKIKAKLEALETGNPMGLEGLEELELESRTIPIWLA
LLICVVYVCGCSSLFLLWETRWTFFTSLYFFCISLSTIGLGDIVPDKPHMFIIMFVLVIV
GLSIVSMFISVVQIKMEEWLYHLIKKIQREYTQAIENGEFPDKGELYKKILEKESPWMQL
VGPTIMSGQQNNKLENTVEKFERLLKESKEIQTELSNRGMSTQVEKYEQSMACDPMSNDL
KPEEHRETQWSRQMVDETVGPSEKMEELKLQRNDATSISRRSNDYRDSISDATSLPMDSM
SSPEMKKKNKMACANCQCDIPSVENHSPIRPAPETRTDGVAQTDLAQFQIDEIAIKLANL
QTQRVRPPIVEMATSAFMEDSPVHSEALDLPRGLSPEEINKICEAMSNSFYQNSQEALKQ
ITDVGVGKDYETNFQDKSQLTSLTLPVPVRSSTANSSTSTTPPSRNSIATSPIVSLCEDF
KKEQKQKQMRSMSTSPFPGNSMQEEETQTSLRQNLVNVATDPCTSQLIQRSTVTSPVGRD
DAETVTIHMRSRQKKQVMFQETSQSVRIEMMDRMVSPVVSTANQRDQNTSPIEKSADYDD
RSMQTSISDWFGKILKRKDESQQTSISEDVGKSKDKKKKKVSKEENSQASSLGSDVLTSS
NTSSASESLKDSEKKKKKTFIAPNMSASVSMSTQYSPPPGCDRLSVEPYSTRARSSSTSG
MGTSIFEEETRQEVIVQTDDSYLKIARRLDEYRNNKTQFLPVCAAAPLSSKEVEPFKSDR
PSERSHYYFGGRRASRRKSRQDLKHGESQTGQSMDAELLKEVLCLLKIHFQSSEKSRSIS
PKRPCKQRGILARHPSLPTGISRGKVSDYVIQHEKGIHNPATNRQSPIKIIRQYSLDQDV
L
Download sequence
Identical sequences A8XHH2
CBG13286 6238.CBG13286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]