SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13488 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13488
Domain Number 1 Region: 26-64,158-230
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-26
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 275-367
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-23
Family Voltage-gated potassium channels 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13488   Protein: CBP28363   Gene: WBGene00034246
Sequence length 983
Comment CBP28363 WBGene00034246 locus:Cbr-twk-2 status:Predicted UniProt:A8XHM5
Sequence
MEDFKEIEGLLESARPDDDENTTTLQNIRKYAKLALPHIVLVVCVCIYATIGAWIFYTLE
SPNEDRLKETGRKTIVEMRNNLIHKINHNDEKEWKQDIEKELMLYSEKLYKAFKEQYVRY
SDVRNLGYEYRVGSEEDDGDNERKRRHRHGKNRGEKGSEKMWTTSSALFFAATTMATIGY
GNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYKHMRKGSARMETAWRR
FRGLEDSINDDLESASKNQESSILDMEMDEIDKSEVPVLMVFTIILLYIAFGGILFSILE
DWSYMDAFYYSFISLTTIGFGDIVPENHDYIAIMLIYLGVGLSVTTMCIDLAGIQYIQKI
HYFGRKFQGTDLLQYLKKKRMLERRLAMGQGEEILRKYVHAVEKFEREQEQQLQQRIEDE
PPSIESKAFDNSLMRIDDSLSAFQLRFYDTYDEEDLFSPTIHSVRSFQPSVWSHSSARST
SYCRFQRNRGASWDESGPSLSEHCSLSTEPSVHIRQAYWDNYHSPTPSVISFLHRHLYSP
SVASSISFDYDCLAKDAKSARRSNSCPPIDLPSPPPSNSVSQRPLSARTSSSRPKHAYAA
EPIFSAAPLSFRLPEPFMLSNLAAICDAFDMDACNNLVFGAFRESQLASNRHDGDGLDEC
AMRPPPMVAQAPHVPKLLLSPKRLSVIDENKIATSPEPLLKRKHKERVAKQQNPLTSFDW
LNVSPRKFRPELLIKEDLPKLFKLVRNSTKRSLESPTQTSETTLPDLSCESSPDSVVLIS
PRSTHFSSKYFQPIGLACMQDWDSYIQMLEEASRQFEYPPEDIEEAEEEEEFEEEEEVED
ERECIPHVCIRLRVSGIFTSSIATTSSKEQLHSAPKVYYQPRPSRLTQCSNLSNRSYELP
EIIPEEVHETKIPSPVSFEPQSSESEEEPMAVYVEEEKRIPQNDIDLGAFELVDSVEHPL
DSFQLEGILRIGKNDTCSEHLEK
Download sequence
Identical sequences H8WGV8
CBG13488 6238.CBG13488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]