SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14123 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14123
Domain Number 1 Region: 70-112,178-244
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-22
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Domain Number 2 Region: 255-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-19
Family Voltage-gated potassium channels 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14123   Protein: CBP35203   Gene: WBGene00034722
Sequence length 526
Comment CBP35203 WBGene00034722 locus:Cbr-twk-26 status:Predicted UniProt:A8XJC8
Sequence
MDVDIKESEIQTRSRIIKNHLTERNNCIVLKIDTHMSKVEDMSPFGFHFEFDAKKYKERK
KQIRKQKITRFFAWLAYYHHKFGIRHITLVALLVGYVFLGGFMFEKLESPRELEDLKETI
VLMQGIIDEETQDIINLTLSTNGTDRNNKLAKLIKRYYKTMLEAEGRFHGSVWHKAENLD
MHLMWYFSSATFYSMTLFSTIGYGTISCQTTWGRILSMIYASIGLPIMLVVLGDIGEWFQ
KVLTSGYVFLLLKYKNLRKQPLTKKKHDILLPMWLALFLVLAYILICTLTITIFDHNEGN
KPGIGFFDAFYFTFISLTTIGLGDVMPYNIQYSPFLAAAFLLGLALISIVNTSIYAQLYR
MFFNLINSVEDKLDRIHSSSHRGPGYRVFQNMEPVFRMLVCTFPPSHPQTRIKFAAVIRD
SFREKKEKRDKDRKRESNTSDQIKLRTRTESDIPAHDGFHLWMANRAKKRQQEMSEDDAA
VAARRRAPTLGAFGGFDMNLFKPRGRANTSPFQREDSAETEESDVE
Download sequence
Identical sequences A8XJC8
CBG14123 6238.CBG14123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]