SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14128 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14128
Domain Number 1 Region: 17-48,97-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-19
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 170-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000183
Family Voltage-gated potassium channels 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14128   Protein: CBP31837   Gene: WBGene00034726
Sequence length 565
Comment CBP31837 WBGene00034726 locus:Cbr-twk-16 status:Predicted UniProt:A8XJD2
Sequence
MHNLQSKKQAFEVEHAKPFTLHCSLLMLVLLYSFLGGFVFDRIETDAHAEMKRNERTNRT
SCVSQILHSVHRWSRNYTHQEQLAEQIADCFEPEKDERSEWNFVTATLYGFGIVTTLGYN
RIAPITYTGRMFCIVYGICGIPVTMIIIANVGQYLNNFAGDSRRKIEAYRQQRRMSKASL
AGKVYKESSIQVTSLALLCVFLAYVGVGALLLPLLNGELDFFNGLYFNFLCLTAIDFGQL
VPIRVELLPITFLYVCIGLAITTIAISKRKFFKGDFLFFILDIGSEYMKKLHYWGKKMKN
AAQTRIWFGGKTLKVRDLLHAVGKKCGVEPGMIDALDLENVVERTIAIQEGREPPEDLND
EPREPSPRSIIHSPCSTRPSNPPMSPPSPREDHPFIFKMDTPAPRSPLPLPSYELDIKKP
IFQALSNEFMNQSAQEKLFDDLDTFHVELNTELVEDNKCESVIIIEPPATFEDMTVQSSL
NVEDYEKEEKAPKRFREKKEMYGRDPRKLYETYQEEWDRLERLSDRKHGPRRKSVLNLAT
CSPERSVSPSPIRHSLTGEDNRRNS
Download sequence
Identical sequences A8XJD2
CBG14128 6238.CBG14128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]