SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14385 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14385
Domain Number 1 Region: 65-102,176-247
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-26
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 2 Region: 301-398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-25
Family Voltage-gated potassium channels 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14385   Protein: CBP32968   Gene: WBGene00034906
Sequence length 537
Comment CBP32968 WBGene00034906 locus:Cbr-twk-28 status:Predicted UniProt:A8XJW0
Sequence
MYTHNAVDTFDMVIYHFMFSSQSKRVQGSESSLSSLNEIPMEMDLTTAGPPISDDETEVE
TKEKKFFVYAKRILPHVGLVILLFLYLIAGAFLFRYLEAPKELETRNHELTTILGLRDEF
QDHIWNITQDSDNRISREAFNAINQEYFEQLVKNMFQAYRNQFITAKHLLNKTREDEVLW
TFPNSMFFAATVITTIGYGNLVPITISGRVACIIFALFGIPLLLVTIADIGKFLSEFLSY
LYKSYRGFKRKLRRQSKKITSQYRSQSQSRSSSVMGSSKAGSMNLHDIDSESEDSAGDEL
RIPVFMVLLVLLAYTAIGGFLFQSWEHLEYFEAFYFCFITMATVGFGDIVPNEQVYVFFT
MAYIIFGLSLATMCIDLAGTEYIRKIHYLGTKMEDAKGAVMTGLQAGEHLLKHTGIEVIK
TAGGKLVQVRGAVLSSKEARELGMSYLLQFNYQHKNVLYEPLTGNLAKVVKEANIKILPD
DITEKDGYIVQNKSYDRPVLGERGFVRLNGNAIKRIMIPSRNQAICVPYLIQKESDV
Download sequence
Identical sequences A8XJW0
CBG14385 6238.CBG14385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]