SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14545 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14545
Domain Number 1 Region: 39-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-16
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Domain Number 2 Region: 178-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14545   Protein: CBP25835   Gene: WBGene00035005
Sequence length 360
Comment CBP25835 WBGene00035005 locus:Cbr-mig-13 status:Partially_confirmed UniProt:A8XK59
Sequence
MIKLILILVTLGICCRSEPIASFFDGLDSRNECKARLDRRLTGFSGLLYSHSKYGQEPYN
TSRNCVLMLVAPIGYNIRVRAIEFDVARTENARNCERDTLHVFDHETTLDPESYAPARID
DITSPGPIIGQFCGHFENRILNMSSHNALTLWWHSNPNGSNSKGFKLHWGAFRVSRTGNC
VTGEFSCGNGECIPIESACDRFADCSNGEDLIHSRQMAANCQNIELDPLTTVSGVFVLLF
SATIILSLCGFIMFVCCLCKCLKSSIPIKGAASHTTTTTTTNGEYKPEPPQFYPPSPPKM
PPPSAASGYTPRLHHHFEGPMVPSETSGFHSARHQNHYSVNSDINGDYTYVRNDVHRNLL
Download sequence
Identical sequences A8XK59
CBG14545 6238.CBG14545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]